KEGG   Yersinia pestis D106004: YPD4_3529Help
Entry
YPD4_3529         CDS       T01832                                 

Definition
(GenBank) hypothetical protein
  KO
K07675  two-component system, NarL family, sensor histidine kinase UhpB [EC:2.7.13.3]
Organism
ypd  Yersinia pestis D106004
Pathway
ypd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YPD4_3529
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypd01001]
    YPD4_3529
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypd02022]
    YPD4_3529
Enzymes [BR:ypd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     YPD4_3529
Protein kinases [BR:ypd01001]
 Histidine kinases
  NarL family
   YPD4_3529
Two-component system [BR:ypd02022]
 NarL family
  UhpB-UhpA (hexose phosphates uptake)
   YPD4_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MASE1 Thia_YuaJ DUF3489
Motif
Other DBs
NCBI-ProteinID: ACY60433
Position
complement(4508895..4509695)
Genome map
AA seq 266 aa AA seqDB search
MIQRLVMLLALFFIYFTAAFCLWAIGTQLADRALQSLLLFPFGLRMGILLQSPRAYWPGI
LLGDVLLWWLLADQFDDLYQLWVALPLLLLTTLLALFASPWLLRHQQNESEWQWPLMQGG
VITVAALIQALGWQIASGQGAMALLLGLVGGFTIAPTCLLLWHYLARQIWLPLEPGLIHK
PVNLRLRHILWYLLLFAISIWLQYQVTETDLRLFVPFCLAIPIVFMAYRYGWQGALAATL
LNGVVLLINTPEPLESHRGLLLSLLV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatacagcgcttggtgatgctgctggcgttattctttatttattttactgcggctttc
tgcctgtgggctatagggacacaattagctgatcgggctttacagtcgctgctgttgttc
ccatttggtctgcgtatggggattttattacaaagtccacgtgcttactggcctggcatt
ttactgggtgatgtcctgttgtggtggctattagccgatcaattcgatgatttatatcag
ttgtgggtcgccttgccgctgttgttattgaccaccttattggccctttttgcctccccg
tggttattgcgccatcagcaaaatgagagcgaatggcaatggccgttaatgcaggggggc
gttatcacggttgccgcgctaatacaggcgttggggtggcagatagccagtgggcagggc
gcaatggcgctcttattagggttggttggtggctttaccatcgcgcctacctgcctgctg
ctgtggcactatctggcacgtcaaatctggttaccgcttgaacctgggttgatacataaa
ccggttaacctgcggttgcggcatatcctgtggtatctactgctatttgccatcagtatc
tggttacagtaccaagtgactgaaacagatttacgcttatttgtaccgttctgtttggcg
atccccatcgtgtttatggcatatcgctatggctggcagggggcgttggcggccacgtta
ctcaatggtgtagtgctcttgattaatacacctgaaccccttgaatctcatcgtggcttg
ctactttcactgttggtgtaa

DBGET integrated database retrieval system