KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0136Help
Entry
YPO0136           CDS       T00063                                 

Gene name
ompR
Definition
(RefSeq) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YPO0136 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ype02022]
    YPO0136 (ompR)
Two-component system [BR:ype02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   YPO0136 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-GeneID: 1172982
NCBI-ProteinID: YP_002345222
UniProt: A0A384LC72
Position
148695..149414
Genome map
AA seq 239 aa AA seqDB search
MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGNKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaatcacaagattctggtcgttgatgacgatatgcgtctacgtgcgctactc
gaacgttatttgacggagcaaggttttcaggtccgcagtgtggctaatgctgaacagatg
gatcgcttgctgactcgtgagtccttccacctgatggtacttgacctgatgttaccgggc
gaagatggtttgtcgatttgccgccgcttgcgtagtcaaagtaatccgatgccgatcatt
atggtgacggcaaaaggcgaagaagtggaccgtatcgttgggctggaaatcggtgcggat
gattatattcccaagccattcaaccctcgcgaattactggctcgtatccgtgcggtgctg
cgccgtcaggcaaacgaactgccgggagcgccttcacaagaagaggcgatcattgcgttt
ggcaaatttaaactgaatctgggcacgcgcgagatgtttcgtgaagatgagcctatgcca
ctgactagcggtgaatttgcggtgcttaaagccttggttagccacccacgtgagccgttg
tcccgcgataagctgatgaatctggcccgtggccgtgaatacagtgcgatggaacgttct
atcgatgtccagatttctcgtttgcgtcggatggtggaagaagatccggcccatccgcgt
tatatccagacggtgtggggtctaggctacgtctttgtaccggacggcaataaagcatga

DBGET integrated database retrieval system