KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0501
Entry
YPO0501           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO0501
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO0501
SSDB
Motif
Pfam: VipB VipB_2 DUF3386
Other DBs
NCBI-GeneID: 1173346
NCBI-ProteinID: YP_002345574
Position
534285..535796
AA seq 503 aa
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVK
VNRDVVLTIESLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRV
LNISQDELGKTLRRYRGSAWDQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVAL
LTELAKVAAAAHCPFITSSSPSIMQMNNWRELGNPRDIGKIFTTPEYAPWRRLRESNDSR
YLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFTWANAAYAMGVNINRAFNEYG
WCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNAGFLPLVYRKN
SDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQ
LEGMTVSLRLVSKLPSNKESEKK
NT seq 1512 nt   +upstreamnt  +downstreamnt
gtggagaacatgcagaaagcccaactcaatgacacgccagacatcaacgtcgatctggct
gaaaacgagttagatgacattttaaaacgttcttttcgccctcgaactgacgaagcttcc
gccacagtgcgccgtgccataggcacgcttgctgcgtatgccaataaaggccaagtgaaa
gtcaatcgtgatgtcgtactgaccattgagtctttagtcgctgaaattgacgaaaaactt
tccgatcaaatgaaccttattctgcaccataaagagttccaaaagctggaatcagcttgg
cgcgggcttagctatcttgttgataatacagatgctaatgaaactttaaaaatacgggta
ctgaacattagccaagatgaactggggaaaacgcttcgccgttatcgtggctctgcatgg
gatcaaagtccgatatttaaacaggtctatgaacatgaatatgggcagtttggtggggaa
ccttttggttgcatgatcggtgattatgaattcgatcacagtccacagagtgtggctctg
ctgaccgagttagccaaggtggccgccgccgctcactgtcctttcattacctcttcttcc
ccaagcatcatgcagatgaataactggagggagctgggtaacccaagggatatcggcaaa
atctttaccacacctgaatatgcgccatggagacgtttacgtgagagtaatgactcccgc
tatctggtactgactctgccacgttttctttcgcgtctgccgtatggtgccaaaaatcat
cctattgatgattttgcttttgaagaagtggttagccctcatgccagtgaggatttcacc
tgggcgaatgcggcctatgccatgggcgtcaatattaaccgggccttcaatgaatatggt
tggtgttcaaggatccgcggtattgagtcgggggggtccgtagaagaacttccggcctat
gcttttccttctgacgaaggcggatatgaactcacttgtccgacagaattggcaatttcg
gaccgtcgtgagaacgagctatccaatgctgggtttttaccgctggtctaccgtaagaac
tcagactttgccgcctttatcgggtcgtgcaccctgcatgcaccggcaaactatgatgac
cccgatgcgacggcgaacgccagattatcggcccgtttaccttacatttttgccacctgt
cgtttcgcccattacctcaaatgtattgtgcgcgacaaaattggttcgttccgctcgcgg
gatgacatgcaactttggcttaacgactgggtgatgaactacgtcgatggtgacccctcc
atttcaacagaagccactaaagctaaacgcccgctggccgctgcggaagttcaagttgaa
gacgtagaggatgatcctggtttttaccgcgctcacttctatttacgccctcactaccaa
cttgaaggtatgacggtttctctgcggctggtttctaaacttccatccaacaaggaaagc
gaaaagaaataa

DBGET integrated database retrieval system