KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0503
Entry
YPO0503           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO0503
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO0503
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-GeneID: 1173348
NCBI-ProteinID: YP_002345576
UniProt: A0A384KT18
Position
536551..536994
AA seq 147 aa
MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARLKLKKYPHCEASVLNY
GLPSLSQQVPVITDLLELARHIQRIIATFESRLDPRSIKVVPLINKGETWVLAILFDIHA
RCNLPGEEHLVNLRIALDYSYGMVRVL
NT seq 444 nt   +upstreamnt  +downstreamnt
atggatatttcagcaccgatactttttgacaaattaagtctccgccatgaacacgttcgc
ttacctcattggcgtgaagtgattgtgcgcgatattgaatctttattgaatgactccgca
cacagtgcccggttgaagctaaaaaagtatccgcattgtgaggcttctgtattgaattac
gggctgccttcgctcagtcagcaggtaccggtaatcaccgacttgctggaactggccaga
catatacagcggatcatcgccacgtttgagtcacgcctggatccgcgctcaataaaagtg
gtgccgctgattaataaaggcgaaacctgggtgttagccatcctgtttgacattcatgcc
cggtgcaacctaccgggcgaagagcacttggtcaatttacgcatcgcgctcgattactcc
tatggaatggttcgcgttctttaa

DBGET integrated database retrieval system