KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0504Help
Entry
YPO0504           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO0504
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-GeneID: 1173349
NCBI-ProteinID: YP_002345577
UniProt: A0A384KMT6
Position
537027..538871
Genome map
AA seq 614 aa AA seqDB search
MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDPFVERLLEGTAFLSSR
IQQRLNNEHPEFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQWHSRVVLPKGSRVTLS
DSSLNNRLANFSTGRTLKIQPLVIENAECASTPPAYLPLSVASQLQAGQAHLRLRLTTQG
VASLSELDFAPMNLTLAGGIIQSNQLITTLLNNTLHIVLWANTDGKPLVKVLTKEHLRQG
GLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGLNDFLQQGDGIHTFEVLFVLD
QRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHTEYPVIVDPLNPRLYEVHHVL
GVNGLLSEGGSVQFSSLHGHARFDDDDKMAGYSIRRRRDFTDKNHQKNSPLPHDSLFIAL
SPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKLEIALPVGQIEMLRHPAKPQGVP
NIDQAWRALQLIANNPLRYALPDVTDCSPLLKDWLSIFCQHEEASQHKRITSLTHASVAH
NFERHTAPGPIAWSRGVEATLDFNSSHHSDKGAFLFARILHHALSEYCELGQTLRLHMQV
DGETFAKWGPVNYG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgaaagttttctggctctatacaacgaagagttgcgttatctgcgtgaagat
gggcagcgcttcgctcatatgcatccgcaagtcgcccaacaccttgggttacatgctgat
ggtgtgctcgatcctttcgtcgaacggctccttgaaggcaccgctttcttgagttcccgt
atccaacagcgtttgaacaacgagcatccagagtttgctttgcaaatgcttgggcgtttg
gccccactttggtatacacccctgccgtcgattgccaccattgccatggttccggatctt
acgtcaccgcaatggcactcgcgcgtcgtattgcctaaaggtagccgcgtgacattgagt
gacagttcgctgaacaaccggttggcgaatttctctactggccgcacgctgaaaatacag
ccattggtcattgaaaatgccgagtgtgccagcacgccaccggcgtatttaccgctctct
gtggcttcacaattacaagctggtcaggcccatctgcgcttgcgtctgaccactcaaggt
gtcgcgtctttatctgagctggatttcgccccgatgaacctgacgctagcggggggaata
attcagtcaaatcagttaatcacgacactgttgaataacaccttacatattgttttgtgg
gccaacacggatgggaaaccgctggtcaaagttcttaccaaagaacatcttcgccaggga
gggctggatgaacaagaggcgcttttacctgttgcgatcagcgaaatgcctggaaaccgt
ttgctacgagaatattttgctgctccttcgcgttttttcgatctggaactgcatggcctc
aacgacttcctgcaacaaggggacggcattcatacctttgaggtgctgtttgtactggat
cagcgccccctacatttgattgatagggtcactggcaatgacttccgactcttcgccaca
cctattattaacctgttcaaacgccgttgtagcccggtgctgattaatggtgaacacacc
gaatatcccgtcattgttgaccccctgaacccccgcttgtacgaagtccatcatgtactc
ggggtcaacggtttgttgagcgaaggggggagcgtgcagttttcttcccttcatggtcat
gcccgttttgatgatgacgataaaatggcgggttacagcattcgccgtcgccgcgacttc
acggataaaaatcatcagaaaaattcacctttacctcatgacagcttattcattgccctt
tcaccggggaccagcgggatagatattgatcacgtcaagtcgctgtcgattgaagccatg
gtgtgcgaacgccacttaattcccagccaattacagcatccggaattcaagctggaaatt
gccctgccagtggggcagatcgaaatgctgcgtcacccggcaaaaccacagggtgtgccg
aatattgatcaagcctggcgggcgttacaactgattgccaacaatccgctgcgttatgcg
ctgccggatgtcaccgattgttcgccgctgctaaaagattggctgtcgatattttgtcag
catgaagaggcgagccagcataagaggatcactagcctgactcacgccagtgtggcgcat
aattttgaacgtcataccgctccggggccgatcgcctggagccggggggttgaagccaca
ctggatttcaacagcagccaccacagtgataaaggtgcattcctctttgcgcggatcctg
catcacgcgctgtcagaatattgtgaattagggcagaccctgaggttacacatgcaggtt
gatggtgaaaccttcgccaaatgggggcctgtcaactatggctag

DBGET integrated database retrieval system