KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0507
Entry
YPO0507           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPO0507
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO0507
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO0507
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-GeneID: 1173352
NCBI-ProteinID: YP_002345580
UniProt: A0A384KWW8
Position
542557..544905
AA seq 782 aa
MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIEL
PDSAGYRTFFTYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQV
FSKYNFADYRFDIVGNYRLREYCVQFAETDFDFVNRLMEDEGVWYYFEHNEDKHTLVMTD
QQQFPVLEGHYAELSFLPDSEEMRAIREGIQRIQRSQRIHSSEIVLRDFDFLNPRNTLQT
HIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAIQSNGQLLSGESNATGLVPGR
SFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVACKFKALNDDVVYRPQCVTPP
PKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTEDDSSCWIRVVQAWAGKGWGV
LAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQH
ASQLTFDDNRGNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDF
SFSVTGMSVSATGISVSTTGTSLSVTGMSTSVTGVSVGFTLIGTSFTGVSTSFTGVGTSF
TGASNSLTGVSNSMTGCSSSFTGTSNSMTGSSHSMTGMSTSITGHSMSQTGSSSSITGDS
TSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTGSSTSTTGNSVSMTGNSTSTT
GCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVGVDLKTVGMQS
KN
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgcaattaattgagatagagaatgaggttttatcgggccaggatgcttttcctctctcc
ttcaagacgcaggaaaaagtgtcagggaatccatcctaccaactggtatttcaggtagca
gaagcggatctcgatctggtcagtttgctgggggaaatcatcaaagtcaggattgagtta
cctgactcagccggctaccggaccttttttacctatgtgatcgccggtgctgatgaaggg
caacggcaagacaaatttgtttacagcctggaactgagtacctggacgtggtttttgatg
caaaaccgcaactgccggatatttcaggacctgaatattatcgatattatcgaacaggta
ttctccaaatataactttgcggattaccgttttgatatcgtcggtaactatcgattacgc
gagtactgcgtacagtttgcagaaaccgatttcgactttgttaatcgtctgatggaagac
gaaggcgtttggtattacttcgaacataacgaagataagcacacgctggtcatgacagat
cagcaacaattccctgtattggaagggcattatgcagaactgagtttcctgcctgacagt
gaagagatgcgcgccatccgtgaggggatacagcgtattcaacgctcacaacgcatccac
tccagcgaaattgtcttacgtgacttcgatttccttaatccacgcaatacattacaaacc
catatcgaagaaagccgccaacacctgcaaggcgtgccactggaatggtatgactacgcg
gcgggttacaccgatccccagcatggtgagagcatcgcccgtttacgccttgaagctata
cagagtaatgggcagctcttgtctggtgaaagtaatgccacaggattagtgccagggcgc
tcttttgctctggtacagcaccctgataacaaccgtaatcggggattcaaactgatcagt
tgtgactacagttttgtccaggatgggccggacagtgcgagccagggacgtaatgtcgcc
tgtaagtttaaggcattgaatgatgacgtcgtttatcgtccacaatgtgtcacgccaccg
ccaaaggtccctggtgtgcaaagtgccacagtggtcggtgcgcgtgaatcagaagtgcat
accgataagttcgcccgtattcgcgttcactttcactgggatcgttataaaaccaccgaa
gatgatagctcctgctggatccgcgttgtacaggcgtgggccggtaaaggctggggcgtc
ctggcgatgcctcgggtcgggcaagaagtgctggtcaattacgttgacggcgaccttgat
cgcccgatggtgaccgggatcgtctacaacggtgagaacccaccgccttaccgtttacct
gaccacattaactactccggttttgtctcacgctcactgcgctttggtcagccacaacac
gccagccagcttaccttcgatgataatcggggcaatgagcggatcatgctacatgctgag
cgcgacttacaaagaacggttgaacgtaacagtgcgacggccgtcggtcaggataaatac
gacacggtggaacggacggccacggagtggatcaacaaccatatctcctacaaagacttc
agtttctcggtgacgggcatgagtgtctccgcgacgggcatcagtgtctcgacaacggga
acgagcttatctgtcaccggcatgagcaccagcgtcacgggtgtcagtgtgggtttcacc
ttgatagggacctcctttacgggggtgagcacatcgtttaccggtgtcggtacctccttc
accggggccagcaactcgctaaccggtgtcagcaactcgatgaccgggtgtagttcctcc
tttaccggtactagcaatagcatgacaggcagtagccatagcatgaccggcatgagcacc
agcatcaccgggcatagcatgagtcagacgggttccagtagcagcatcaccggtgacagt
acctcctttaccggcagcagcgtcagcagtacgggcagcagcgtcagtacgaccggtgtc
agtaccagcactacggggagtagcacctcgactaccggttgtagcgtcagtactacgggt
agcagcacctcgactaccggtaattcagtcagcatgaccggtaacagcaccagtaccacg
ggatgcagtatttccacgacgggcagcagtattgggacggtaggaagcagtatcagcacc
acgggcagtagcgtcagtaccaccggtagcagtatcagcaccacgggattatccgtcagt
tataccggcgctcaatattccgatgtgggtgtcgatctgaaaaccgttggcatgcaaagc
aaaaactga

DBGET integrated database retrieval system