KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0513
Entry
YPO0513           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO0513
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO0513
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-GeneID: 1173359
NCBI-ProteinID: YP_002345587
UniProt: A0A5P8YL23
Position
549851..551206
AA seq 451 aa
MLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGFHSLSINQGLLDQGKI
ALNQASGVFPDGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLMDIPGNTYIDLKKSNQG
SRFVALDAEVQDRNHGVAAEGTPLIATLQLGQLQSKLTLRASVSDAESMLPVAYIKERTR
DGRLILDDNFLPPMLDFRAIGWIDNAVTELLGLIVQRLESVYRPDVTLSVGGLSELLELL
LLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLLGRLSTIPGGEKPWSRQDLLYTHHEPH
NGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQNDSQLRLEKLIFTVSSKLPSET
IRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRYIPYYPNSVYFEVDHDDPMYKE
MMSGSAIALSIVGDFPELRFEVWGLRQGRLG
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgctgccaaaacaacgtgttgcttgggtggaagggatgctgatggaaccccagcatttt
caacaacaggaacgatatctagaacatttaactgaaatgcgggcacgtagcctcagcgcg
ctggcatggggcttccatagcctaagtatcaatcaagggctgctggatcagggcaagatc
gccctcaatcaggccagtggtgttttccctgacggtacaccttttcatatggcgggtgat
gagccattaccgctaccttttgatccgggggagaactgccaaggcagtgtcgtgtgcctt
tcggtcctgatggatatacccggcaatacctatattgatctgaagaagagcaaccaaggt
agccgtttcgttgcgctggatgctgaagttcaagacagaaaccatggcgtcgctgctgaa
ggaacgccattgatcgccacccttcaactggggcaattgcaatccaagctcaccttacgt
gccagcgtcagtgatgcagaatcgatgctgcccgtagcctatatcaaagagcgcacccgc
gatgggcgtctgattctggatgataacttcctgccacccatgttggattttcgcgccata
gggtggatcgataatgcggtaaccgaattgctagggttgatcgttcagcgactggaatcg
gtttaccggccagatgtgacgctctcagtcggtgggttatcggagttactggaactgcta
ttactgcaaacactcagtgaatataacctaaagatttcacatgtgttgatgcaaaaacag
gtacaccctgagcagttgttccaattattgcttgggttgttggggcgtctcagtactatc
cctggcggagaaaaaccgtggtcgaggcaggatctgctctatacgcatcatgaaccgcac
aacgggtatttctcgctgtttgccgccttacggcgcgcactctcactggtgatcgaagca
ccggcagtggcgctaccgtttatcgaacgtggcgacaatatttacctgtgccagaacgat
tcacaactgcgtctggaaaaactgatcttcaccgtcagttccaaactgccttccgagacc
attcgcacttacttcccggcgcaaaccaaactggggccggtggagaaaattgtacagttg
atcgacctgcaattgcctggcgcacggatgatcccgatgtcatcaccgccaagatatatt
ccttattacccgaatagcgtctatttcgaagttgaccatgatgatcctatgtataaagaa
atgatgtctggttcagctatcgcactcagcatcgtgggtgatttccctgagttgcgtttt
gaagtatggggcttgcgacaaggaaggctcggatga

DBGET integrated database retrieval system