KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0514Help
Entry
YPO0514           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPO0514
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO0514
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA
Motif
Other DBs
NCBI-GeneID: 1173360
NCBI-ProteinID: YP_002345588
UniProt: A0A384LCC8
Position
551203..552813
Genome map
AA seq 536 aa AA seqDB search
MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKE
GLADQAASGNNMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQR
MPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRSWPTRNAAEVRPPIVRELQYF
QQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHL
RVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLA
IAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKI
NIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFINKKNIERLGL
ALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAI
GRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatttgaacgccagatccgtgcagccatttccgcagcacgcaatggcgcaaaa
catgcggaacagtcactgactacaccaatgtggcaagccaaaagcaccgtagcctcattg
ggtgggattgtccctagaagtggctcttcgtcaacgtcacaggcggagaactataaggaa
ggtctcgcggaccaggctgcctcgggcaacaacatggcgcgcacgagtgcgccaccggtc
actttgtatcagcaacagccaaatgcgaatgacagctatccaaacgggaataacaacaat
ccaaacggggataacaacaatccaaacgggagtaacaacaatatagcgagagtacagcgt
atgccgcatggcatttccaggggcttatatgagcgccctgggatgttattgggtgcctgg
gataacgcctatattgctgcggctatgcctttgctgctgctggtggaaaatattcgtagc
tggccgacgcgtaacgccgcagaggtcaggccaccgattgtgcgggaattacaatatttc
cagcaacatttgcagaaaaagaactacccgcaagaagacattaaccacctgtcttacctg
ctatgtacctatatcgatggcatttttaacgggctgcaaaccccagactcctacaaccaa
agtctgttagtggagtttcaccgtgatgcctgggggggtgaggactgcttcgaacatctg
cgggtctatatgaactcgccgaaacagtaccgggaagttctggaattctatgatctgatt
atgtgccttggttttgacggtaaataccagatgatagagcatggtgcggttctgctgatg
gatttacgcagccgtctccacacgcaactctacggtcaggacgccacacaatctttggct
atcgcgcaagcggtcaaaggttctccgcgtcgccaatatatcaaggcgctgaaaatcttc
acctatggtttcgcactgtgcctttgtgcttacggcgtcacggcgtggtatctgcaccag
caatcccaacagatccgcagcaacattctgacgtgggtactgcctgaaccgcggaaaatc
aacatcatggagaccttgccgaatccgctatccaacatcctgaatgaagggtggctggag
gtcaggaaagatccgcgtggatggctattaatcttcacctccgacggcgcgttccgcacg
ggtgaagcgaccctctcggaagagtttatcaacaagaagaatatcgaacgtcttgggctg
gcattagccccatggccgggagatatcgaggttattggtcatacggataacaaaccgttc
cgtagcacttccggtaacaacaacctcaaactttccgcggccagagcatcggtggtggca
gataaactgcgggaatccactcaaatcaacgaaacccatcagcgagaaataagtgccatc
ggacggggggagagcgatcctttagctgacaatgcaacggaagaagggcgcaagcgtaac
cggcgtgtggatatcctatggaaaattggtcagcgcgatgccgataaggccatgaagcaa
ttcctggagaacccaacaccagaagttcaaggaacgaatacccaacaatag

DBGET integrated database retrieval system