KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0978Help
Entry
YPO0978           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO0978
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO0978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-GeneID: 1173816
NCBI-ProteinID: YP_002346025
UniProt: Q0WI63
Position
complement(1085911..1086411)
Genome map
AA seq 166 aa AA seqDB search
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNIN
KNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAM
RNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAPKEG
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttcaagcttccaaaatgagatacctaaagcacgcattaacatcaaattagac
ctgcatactggcggggcgcaaaagaaagtcgaactgcctttgaagttgttggtgatgggc
gattacagcaacggtcaggagcagcgcccgctgtctgaacgtgaaaaactcaatatcaat
aaaaataattttaacagtgtgctggctgaattccaaccgagcctgaaactcgctgtaccg
gacacgctggccggggataacaccgatacagccgtctccctgaccttcaacgacatgaaa
gatttcgagccagaaaacgtggcccgtcaaattccgcaactgcgtgccttgctggccatg
cgcaacctgctgcgagaccttaaatccaatctgctggacaacgccaccttccgccgtgag
ctggaaaatatcctcaaagacgatgccttgagcgatgaactgcgcgctgaactggcggcc
ctggcgccaaaagagggttaa

DBGET integrated database retrieval system