KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1193Help
Entry
YPO1193           CDS       T00063                                 

Definition
(RefSeq) pyridoxal-dependent decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00350  Tyrosine metabolism
ype00360  Phenylalanine metabolism
ype00380  Tryptophan metabolism
ype01100  Metabolic pathways
ype01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ype00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    YPO1193
   00360 Phenylalanine metabolism
    YPO1193
   00380 Tryptophan metabolism
    YPO1193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ype04147]
    YPO1193
Enzymes [BR:ype01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     YPO1193
    4.1.1.105  L-tryptophan decarboxylase
     YPO1193
Exosome [BR:ype04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YPO1193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 1174042
NCBI-ProteinID: YP_002346231
UniProt: A0A384LG47
Position
1342338..1343753
Genome map
AA seq 471 aa AA seqDB search
MTPEEFRRHGYAMIDLIADYRQNIELRGVNPTTAPGEIKSRLSLNAPEKAEPFEHIISDI
EELIMPGLLHWQHPDFFGYFPSNVELSSVLGDCLSTGLGVIGLSWQSSPALTEIEEVATN
WLLKMLGLSVAWSGVIQDSASTATLVALISGRERTSNYALMNKGMQNSDAPLIVYTSSEA
HSGVNKAALLAGFGHNNTRLVPTDEHNAMSPLALKKIIQQDLVKGNRPCIVVATTGTTAA
TAMDPLDAIGDITQRYGLWLHVDSAMAGSAMILPECRHLWCGIEKADSVVINPHKWLGAA
FDCSVYCVQDSEHLIRIMSTNPSFLQSDADGKVRNYRDWGIPLGRRFRALKLWFLIREQG
VEGLQARLRRDIANANWLAEQIKNSDDWKLVAPVVLQTLCIRHEPGGLMGDALDNYTRSW
AEKLNQSGKGYVTPATLGGRWMVRVSIGTLGTERHHVEKLWLLLQSLVKER
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgaagagtttcgccgccatggctatgccatgatcgacctgattgctgattac
cgacaaaatatcgaattgcgtggcgttaatcccacgacagcacccggtgagattaaatct
cgtctgtcgttaaatgcacctgaaaaagcagaacctttcgaacacattatttctgacata
gaagagctcatcatgccagggctattgcattggcaacatcctgacttttttggttatttt
ccttctaatgtagagttatcctccgttcttggggattgcttgagtactgggctgggggtg
ataggtctgtcttggcaatccagcccggccctgacagaaattgaagaggtggccaccaat
tggttgctaaaaatgcttggtcttagcgttgcctggagtggcgtgattcaggattccgcc
tcaaccgccacgttagtggcgctgatcagcggccgagagcgaacatctaactatgcatta
atgaataaagggatgcaaaacagtgatgcacctttgattgtctacacttcatcagaagcc
catagcggagtgaataaagccgctctgctcgctgggtttggtcataataatacccgttta
gtgcccaccgatgagcacaatgccatgtcacccttggcattaaaaaagatcattcaacag
gatttggtgaagggaaaccggccttgtatcgttgttgctacgacaggtactaccgctgcg
acagcgatggatccccttgatgcgattggtgatattactcagcgttatggtttatggctg
catgtggattctgctatggctggttcagcgatgattttgccagaatgccgtcatctgtgg
tgcggtatagaaaaggctgattctgtggtgataaatccgcataaatggctgggtgctgct
tttgattgttcggtttattgtgtacaagattcagagcatttgattcgtatcatgagtact
aaccccagtttcttacaatccgatgccgatgggaaagtgagaaattaccgcgattggggg
atccccctgggtcgtcgttttcgtgcgcttaagctatggtttctaatccgtgagcaaggg
gtggaagggctgcaggcgcgtttgcgtcgtgatattgccaatgctaattggttagcagaa
caaattaaaaacagcgatgattggaaactggtcgcacctgtagtgttgcaaaccttgtgt
attcgtcatgaaccgggtgggctgatgggcgacgcgttggataattatacccgcagttgg
gccgagaaactcaatcaatctggtaagggttatgttacaccagccacgcttggtggccgc
tggatggtgcgggtttccatcggcactttgggtacggaacgtcatcacgttgagaagttg
tggttgttgttgcagtctttggttaaggagagataa

DBGET integrated database retrieval system