KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1433
Entry
YPO1433           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K09911  uncharacterized protein
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    YPO1433
SSDB
Motif
Pfam: MatP MatP_C RHH_4 PPS_PS TMF_TATA_bd Seryl_tRNA_N
Other DBs
NCBI-GeneID: 1174273
NCBI-ProteinID: YP_002346454
UniProt: Q8ZG78
Structure
PDB: 
3VEA 3VEB

Position
1625920..1626375
AA seq 151 aa
MKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDA
HMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVV
QLIEDAERKEKYASQMSSLKQDLKDILDKEV
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaatatcaacagctggaaaatcttgagagtggttggaaatgggcgtatttggtcaaa
aaacaccgtgaaggtgaagccattacccgccatattgaaaacagtgcagctcaagacgca
gtagagcaactgatgaaactggaaaatgaaccagtaaaagtgcaagagtggattgacgcg
catatgaatgtcaatctggcgaccagaatgaaacagactattcgtgcccgtcgtaagcgc
cactttaatgccgagcaccagcatacgcgtaagaagtcgatcgacctggagtttttggtt
tggcagcgattggcagtattagccagacggcgtggtaatacgctttcagatactgtggtt
cagttgattgaagatgctgagcggaaagagaaatatgccagccagatgtcttctttgaag
caggacttgaaagatattttagataaagaagtttaa

DBGET integrated database retrieval system