KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1467Help
Entry
YPO1467           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO1467
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-GeneID: 1174307
NCBI-ProteinID: YP_002346485
UniProt: Q74QK3
Position
1658499..1659851
Genome map
AA seq 450 aa AA seqDB search
MKIERPLWTRGVLISPQQFQQQASWEAWTNECIAQMAVMHPWGVLQATFELDALAQGRLK
AARLHVRFQDGVLVDTECADVLPPTLTLAASLPVEASDATVMLAIPQLYANGGNCLQPDE
RGERPVRHRQAWRDVQNQFGDDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLRDAQGR
WTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMRRESNARMADFAVADVSLF
WLLNALNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLTFSLEHEVTAIPVYQHEQLTR
VFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLRDPRLREGADFYLSVRSSLPA
AQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
TQMMETGACVFYVPGTLGEIQLELFAVLRA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgaacgtcctctgtggactcgcggagttttgatttccccgcagcaatttcaa
caacaggcctcctgggaggcctggaccaatgaatgcatcgctcaaatggccgtgatgcat
ccctggggcgtgcttcaggccacttttgaattggatgcattggcacagggccgcctgaaa
gcggcgcgtttgcatgtgcgttttcaggacggtgtgctggtggataccgagtgtgctgat
gtgctgccgcccacgctgacgctggcagccagtctgcccgtcgaggccagcgacgccacg
gtgatgctggcgataccacaactgtatgccaatggcggtaactgcctgcagccggatgag
cggggcgaacgcccggtacgccatcgtcaggcctggcgcgatgtccaaaatcagttcggc
gatgacaaaaagcaggtcgcggtgatgtaccaccaactgaccctgcggctggacactcag
gaaaacggcgattatcaggtctgcccggtggcgcgcttgctgcgggatgcgcaaggtcgc
tggacactggatccgggctttattccgccgatgctgagcctgcaggccagtgcctggtgt
ggcgaacagcttgagttattgatggtgcaactgcgggcgcgtttacagcgtctgatgggg
atgcgccgggagagcaatgcacggatggccgattttgctgtcgcggatgtgtcgctgttc
tggctgctcaatgcccttaacagtgccgaaccggtactggggaattttcagcgctatccg
caggttcatccagagcgcctgtatcaggagctggccaggctggcgggcagcctgctgacg
ttctcccttgagcacgaagtgacggcgatcccggtttatcagcatgaacaactgacccgc
gtctttcccccgttgtttgccctgctgaatattctgctggaagccagcctcccatcacgg
gtggtggcgattgagctggttcatgaaccgcgtatcaatcagtggcgcgcgaccctgcgt
gaccctcgtctgcgcgaaggggccgatttctacctgtcggtccgttcctcgttgcccgcg
gcccaattgcagactcagttcccgcagttgtgtaaagccggtgcgccagatgaggtcggt
aacgtggtgaatgtcgcgttgagcgggatcccactgcgtccgctgagccatgtcccagcc
gccatccccttgcggctggaaaaccagtacttctcccttgatctcagccaccctgcggcg
acgcagatgatggagacgggggcctgtgtgttctatgtacccggtacgctgggtgagatc
caactggagctgtttgcggtgctacgcgcatga

DBGET integrated database retrieval system