KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1483Help
Entry
YPO1483           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO1483
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N
Motif
Other DBs
NCBI-GeneID: 1174321
NCBI-ProteinID: YP_002346498
UniProt: Q0WGU0
Position
1681348..1682949
Genome map
AA seq 533 aa AA seqDB search
MATLTTLLTACAAEPEPLLQQARQQVALWERWLQPVTPDKHTGEDPGYDDHFQQMREEVN
KLSGADTTLTCELAEKLFTTHGKDVRVATYYVWARLHRDGEAGLADGLSLLAGLITRFGE
GLHPLRTTSRKTALEWLAGSRMRDSLSLYPEVDKADFERIVGALALIEQRLSLWDEGVRP
QLGGLYTALENRLAQSGGLNAVVPQNSSGSSSAGSLNPANTASPALRPVQSGRDLLDQTK
TLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVNGRTRLVPPRPEYRVQLKRLYLQQ
NWLALLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWASCITQDLRLLLTRLPGL
EGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVSSGEDGILLLEPEALAQADSEG
IEAALNWLQSRPGITTARHQWLLRLVMARVAEQYGKNDMALHLLSGLDSSGALLTLPQWE
PGLVFEVKARRLKLLRMKAQRGDSDKTRLHAEMESLLSGLIALDPARAAVLCG
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgttaactaccttgctcaccgcttgtgccgcagagcctgagccacttttacag
caggccagacaacaggttgcgctctgggaacgttggttgcaaccggtgacacccgataag
cataccggtgaagaccccggttacgatgaccacttccaacagatgcgtgaagaggtcaat
aagctctcgggtgccgataccacgctgacctgcgagctggctgaaaagctgttcaccaca
cacggcaaggatgtgcgggtggcaacctattacgtctgggcgcggttgcaccgtgacggc
gaggccgggctggcggatggcctttccctgctggccgggctgatcacgcgctttggtgag
ggcctgcatccgctgcgtacaaccagccggaaaaccgcgttggagtggctggccggctcc
cggatgcgcgacagcttgtcactttacccggaagtggataaagccgattttgagcgtatc
gtgggcgcactggcccttatcgaacagaggctcagtctctgggacgaaggcgtccggccg
caactgggcgggttgtataccgccctggaaaaccgcctcgcgcaatctggtgggctaaat
gccgtggtgccgcaaaacagcagcgggtcatcatcggcaggcagcttgaacccagccaac
acggcgtcaccggcgttgcggccagtgcaatcgggacgtgacctgctcgatcagaccaaa
acgctggcaaaatacctgcgcaaccagccgcagggctggctctccgggcatcatcttatc
aaaagcgtgcgctgggatacggtacatcagtcaccgccattagatgtgaacggacggacc
cggctggtaccgccgcgcccggaatatcgcgtacaactcaagcgcctttatctgcaacaa
aactggctggcgttgctggaacaggccgaatcgatatttgccgaaggggttaaccatttc
tggctcgatgtgcagtggtatctgcatcaggccctcagcaaagcgggggccccattcgat
ggctgggcgagctgtatcacgcaggatttacggttattactgacccggctgccggggctg
gaagggctatgctggagtgacggcacgccatttgccgatgaggtgacgctggggtggata
aaccagcaggtactggagtcggtctcgggctggggcagcgagccggccgccgtttcatcc
ggtgaggatggcattctgttgctggagccagaagctttggctcaggcggacagcgaagga
attgaagcggcgcttaactggttgcagtcacgaccggggatcaccacggcgcgccatcag
tggctgctgcgtctggtgatggcccgggtggcggagcagtacggtaagaacgatatggcc
ttgcatctgctgagtggccttgatagcagcggcgcgttgttgaccttgccacagtgggag
ccggggttggtgtttgaagttaaagcccgccgtttgaagctgttgcgtatgaaggcacag
cggggtgacagtgataaaacccgcctgcatgctgaaatggaaagcctgctcagtgggctt
atcgccctcgacccggcccgtgcggccgtattatgcggataa

DBGET integrated database retrieval system