KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1485
Entry
YPO1485           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO1485
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO1485
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-GeneID: 1174324
NCBI-ProteinID: YP_002346501
UniProt: A0A0H2W4Q1
Position
1684716..1686479
AA seq 587 aa
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTEGLVSLLWPHYLRTIPSLSIVEFTPQWQGMKERMGVSKGFEVLSRPIG
ERETRCRYTTTQEMDLLPLTLRRAGLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYF
DADAPLACALHEALTLNTAKLWIRLPGQADRQPLDGHFAPLGFGEQDTLWPKADSAFSGY
QLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLEKRWQHDFSFSEKNLRLHCVP
VINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQVYVPFTSFRH
KGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAE
VLRGTLALYDWTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGD
ICLFGEMLSRFFALYTDIHLFNRLTLILQPTGERLEWEENHQSRLPG
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggacgacttaaccctgcgttattttgacgctgaaatgcgctacctgcgcgaagcgggc
gaagagtttgctcgtgcgcaccctgatcgggctgccggattaaatctggataaagccggg
gcgcgtgacccctatgtcgaacgcctatttgaaggctttgcctttctgatgggccgactg
cgggaaaaactggatgacgacctgccggaactgaccgaagggttggtcagcctgctgtgg
ccgcactacctgcgtaccattccgtcgctttctattgtggagttcaccccacaatggcag
gggatgaaagagcgcatgggggtgagtaaaggttttgaagtgctgtcccgccccattggt
gaacgtgaaacccgttgccgctataccaccacgcaagagatggacctgctcccgctgacc
ctgcgccgtgccgggctggacagtgaacccgatggccggtcggttatccggctgcgcttt
gattgcagcgcgctggccgactggagccgtatcaacctgagccgcctgccgctctatttt
gatgccgatgcgccgctggcctgcgccctgcatgaggcgctgaccctgaataccgccaaa
ctctggatccgtttgccggggcaggctgatcgccagccgctggacggccatttcgcgccg
ctggggttcggggagcaggatacactgtggccgaaggccgacagtgcgttcagtggttat
cagctcttgctggagtactttaccttccgcgaaaagtttatgtttgtcgcgttgcagggg
ctggatgggatcgagctgccggcggaactgccgtggtttgagattgatgtggtgctggaa
aaacgctggcaacatgatttctcgttctccgaaaagaacctgcgcctgcattgtgtgccg
gtgattaacctgttcccgctggaatcggacccgctgtcactttcttcattacagaccgaa
tacctgctgcgcccaatgcgcattcaggacggttataccgaagtgtattcggtggactcg
gtgatctcctcccgtcataccgggcatcaggtctatgtccctttcaccagctttcgccac
aagggggggatgttgcgccatgatgcgccggagtattactaccatacgcgggtcaaacgc
gggccttcggggttacacgatacctggctggtgctggggggcgaggcgtttgataaccac
agcgtaccggataatgaaaatttgtcgctgagcctgaccggcaccaacgggcagttaccg
cgtaaagcgctgcaaagcacggtgctggatacggcggtgaaatccaccggggctcaggtg
cgggtgcgtaatctctccgcgccgtcattgccatgctacccgccgaaccgcgaccgtttt
cactggcgggtgctgagccatctgggcagtagttttctgtggatgatggataacgccgaa
gtgctgcgcggcacgctggcgctgtatgactggacggacaacgaaatgaaccgccgtcgg
ctggaggcgatcgccgaggtcaaacacagcgagattgaacgctttgagcggggctatttg
ctgcgcggggtgcacattgaaatcaccctcgacagcaacggctttaccggtaccggggat
atttgtctgtttggggaaatgctcagtcgcttctttgccctgtataccgatattcacctg
tttaatcgtctgactctgatactgcaaccgacaggagaacgtttggaatgggaagagaat
catcagtcccgccttcccggctaa

DBGET integrated database retrieval system