KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1489
Entry
YPO1489           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO1489
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO1489
SSDB
Motif
Pfam: VasL ImpA_N EF-hand_7
Other DBs
NCBI-GeneID: 1174328
NCBI-ProteinID: YP_002346505
Position
1688561..1689928
AA seq 455 aa
MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPDVDWVRVEQLCLALFRQNGVELQ
TAVDFTLARTHTVGLAGLCEGLELLAGLVCHQWRGLWPPQTHARVALLAWLSDRLQQVWR
TMTLCYGDLAQVYRAERALEQLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGL
AKPRGASEPPESLRFASVPVSEPLVYIISEPAPPPVQVVLPASPPRWKAGHGFAAGLSLM
AVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIAELKKQASDVEWARLAEPVLQ
ASAMQLDQLTQLPPLWAQARGDALLSQAQQLWPTNQEVKRLNALWQQQRAAGAAPLVELK
HYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggcaggtaataccgagcgtctgctgaaaaccggtggcgatccgcgcgcactggcggat
ttcaccgcactgcggggtgaattaaataaactggcccacccggcccgcccggatgttgat
tgggtgcgagtcgagcagctttgtttggcgctgtttcgccagaacggcgttgagttacag
actgccgttgattttaccctggcacgaacgcacaccgttgggttggcgggcttatgtgaa
gggctggaactgttggcggggttggtctgccatcaatggcgtgggttatggccaccgcaa
acgcatgcccgggtggcgttactggcctggttgagcgaccggctgcagcaagtgtggcgc
accatgacgctgtgctacggtgacctggcgcaggtgtaccgggcagagcgggcgctggaa
cagttgtgtacgcagttgcaaacgctggagctcaaacatttgtgcaagctggacggggtt
cgtttgatgctgcataacgcggcgcagcggttggaaagtaccgaggccgtgtctggcctt
gcgaaaccacggggtgcctctgaaccgcccgagtcgctgcgatttgcctctgtcccggtc
agtgaaccactggtgtatattatcagcgaaccggccccgccacctgttcaggtggtttta
cctgcctcacctccgcgctggaaggcgggccacggttttgccgcggggttatcgttgatg
gcggtactgatggccggcagtttcgttatctggcagtcggtatcatcggatcccgtgagg
gaaacattgctggccactgccagtcctttgccgataccgctgagtgctaactcaatagct
gaactgaaaaaacaggcttcagatgttgagtgggcacgtctggcggaaccggtgttgcaa
gccagtgcgatgcagttagatcaactaacacagttaccgccgttatgggcgcaggctcgg
ggggatgccttgctatctcaggcgcaacaactgtggccgaccaatcaagaggtcaaacga
ctgaatgcgttgtggcagcaacagcgagcagccggtgctgcgcccttggtagagttgaaa
cactatgcattggcgcaagaccgtttgcggcaactggcagaacgactgaatagtctggat
gagaaaaaacgcggatatatgacggtctccgaactgaaatctgccgtctttgctatccaa
cagccgctggcacaggccgtgccactggaagaactgctgcggcaatatcaggaacaatta
gaatcagggcaaactccatcctcagcactgcgtcaacagattgacagccggtttagtcaa
ttgctgaaccgctatgcgttgctggtcgtacctcctggcgttcagtaa

DBGET integrated database retrieval system