KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1539Help
Entry
YPO1539           CDS       T00063                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00040  Pentose and glucuronate interconversions
ype00052  Galactose metabolism
ype00500  Starch and sucrose metabolism
ype00520  Amino sugar and nucleotide sugar metabolism
ype01100  Metabolic pathways
ype01130  Biosynthesis of antibiotics
Module
ype_M00362  Nucleotide sugar biosynthesis, prokaryotes
ype_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPO1539 (galU)
   00052 Galactose metabolism
    YPO1539 (galU)
   00500 Starch and sucrose metabolism
    YPO1539 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    YPO1539 (galU)
Enzymes [BR:ype01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YPO1539 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 1174378
NCBI-ProteinID: YP_002346555
UniProt: Q7CHS0
Position
1754023..1754913
Genome map
AA seq 296 aa AA seqDB search
MKCLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVDECVAAGVKEIVLVSHSSK
NAIENHFDTSFELEAALESRVKRQLLKEIKNICPADVTIMQVRQGHAKGLGHAVLCAKSM
VGDNPFIVMLPDVLLDDSTADLSKENLASMIKRFEETGHSQIMVEPVPKADVSKYGIADC
GHVALAPGESTLMTAVVEKPSIAEAPSNLAVVGRYVLSKNIWPLLEKTPRGAGDEIQLTD
AIAMLMQQEPVEAFHMTGKSHDCGDKLGYMKAFVTYGVRHHTEGEKFTAWLKQQLD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttaaaagccgtcattcctgttgctgggcttggcacccgtatgttgcccgcg
actaaagctattccgaaagaaatgctcccggtcgtcgataaacccctgatccagtatatt
gtggatgaatgtgttgccgcaggggtcaaagagatcgtactggtgagccattcatctaag
aatgcgatagagaatcattttgatacttcatttgagctggaagccgcgctggagtcacgg
gttaagcggcagttattaaaagagatcaaaaatatttgcccagcggatgtcaccattatg
caagtgcggcagggccatgctaaaggtctagggcacgcagtgttatgtgctaaatcgatg
gtgggggacaatccttttatcgtcatgctaccggatgtactactggacgattcaacggct
gatttatcaaaagaaaatcttgccagtatgattaaacgcttcgaagaaaccggtcatagc
caaatcatggttgagccagtgcccaaagcggatgtctccaaatacggtattgcggattgt
ggccatgtggcattagcaccaggcgaaagcacgttgatgacagcggtggtagaaaaaccc
tctatagccgaggccccgtctaaccttgctgtagttgggcgctatgtattgtctaaaaat
atctggccgttgcttgagaaaacaccacgtggtgcgggggatgaaattcaactgaccgat
gccattgcgatgttaatgcagcaagagcccgtagaggcatttcatatgacgggcaaatct
catgattgcggcgataaactgggctatatgaaagcttttgtgacttatggcgttcgtcat
catactgaaggtgaaaagtttactgcctggctaaaacagcaactcgattaa

DBGET integrated database retrieval system