KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2634Help
Entry
YPO2634           CDS       T00063                                 

Gene name
fur
Definition
(RefSeq) ferric uptake regulator
  KO
K03711  Fur family transcriptional regulator, ferric uptake regulator
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ype03000]
    YPO2634 (fur)
Transcription factors [BR:ype03000]
 Prokaryotic type
  Helix-turn-helix
   Fur family
    YPO2634 (fur)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR SR1P PadR HTH_12
Motif
Other DBs
NCBI-GeneID: 1175467
NCBI-ProteinID: YP_002347588
UniProt: P33086
Position
complement(2963585..2964031)
Genome map
AA seq 148 aa AA seqDB search
MTDNNKALKNAGLKVTLPRLKILEVLQNPACHHVSAEDLYKILIDIGEEIGLATVYRVLN
QFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSNESIESLQREIAKQHGI
KLTNHSLYLYGHCETGNCREDESAHSKR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaacaacaaagccttaaaaaacgctggccttaaagtcacactcccccggctt
aaaattctggaagtgttgcaaaatcctgcgtgtcaccacgtcagcgcggaagatctttat
aaaatactgatcgatattggtgaagagattggcttagcaacggtttaccgtgttctgaac
caatttgatgatgctggtattgttacccgccacaatttcgaagggggtaaatcagttttt
gagctgactcaacaacatcaccacgatcacctaatttgcctggattgcggcaaagtgatc
gagtttagcaacgaatccattgaatcacttcaacgtgaaattgctaaacaacatggcatc
aagctgactaatcatagcctgtatttatacggtcactgtgaaaccggcaattgccgtgaa
gatgagtctgcacacagtaaaagataa

DBGET integrated database retrieval system