KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2716Help
Entry
YPO2716           CDS       T00063                                 

Gene name
lepA
Definition
(RefSeq) GTP-binding protein LepA
  KO
K03596  GTP-binding protein LepA
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU LepA_C EFG_C GTP_EFTU_D2 MMR_HSR1 EFG_II Ras RF3_C SRPRB
Motif
Other DBs
NCBI-GeneID: 1175546
NCBI-ProteinID: YP_002347663
UniProt: Q8ZD74
Position
3043412..3045211
Genome map
AA seq 599 aa AA seqDB search
MKHIRNFSIIAHIDHGKSTLSDRIIQICGGLSEREMAAQVLDSMDLERERGITIKAQSVT
LDYHSKDGQTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAM
EMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAIRCSAKTGVGVPDVLERLVRDI
PAPEGDPNGPLQALIIDSWFDNYLGVVSLIRIKNGSLRKGDKVKVMSTGQSYNADRLGIF
TPKRVDRDVLNCGEVGWLVCAIKDILGAPVGDTLTLTRNPAEKSLPGFKKVKPQVYAGLF
PISSDDYESFRDALGKLSLNDASLFYEPESSTALGFGFRCGFLGLLHMEIIQERLEREYD
LELITTAPTVVYEVITTNQETVYVDSPSKLPALNNIEELREPIAECHMLLPQEYLGNVIT
LCIEKRGTQTNMVYHGKQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQTSDM
VRVDVLINNERVDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARS
TVKQLRKNVLAKCYGGDVSRKKKLLQKQKDGKKRMKQVGNVELPQEAFLAILHVGKDSK
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacataagaaacttttctattattgcccatattgaccacggtaagtcgacgctg
tctgatcggattattcagatctgtggcggtttatctgagcgtgaaatggccgcacaggta
ctggattccatggatctagaacgtgagcgtggtattaccatcaaggcacagagtgtgacg
cttgattaccattcgaaggatggtcaaacctatcaacttaactttatcgatacccccggc
catgttgacttctcttatgaagtttcacgctctttagccgcgtgtgaaggggctctattg
gttgtggatgcagggcaaggcgttgaggctcagacgctagcaaactgctacaccgcgatg
gagatggacctggaagttgttccggttctgaacaaaattgatttgcctgctgccgatcct
gagcgggttgctgaagaaatcgaagacattgtggggattgatgccactgatgcgattcgt
tgctcggcaaaaaccggtgtgggcgtgcctgatgttcttgagcggttggtccgcgatatt
ccagcccctgagggggatccaaatgggccattgcaggcattgattatcgattcctggttt
gataactacctgggtgttgtgtcattaatacgtatcaagaatggttcgttgcgtaaaggc
gataaagttaaggttatgagtaccggccagagctataacgcggatcgtttagggatattt
acaccaaaacgtgttgatcgtgatgttctgaactgcggcgaagtaggctggttggtttgt
gcaataaaagacattcttggcgcacctgttggcgatacattgacattaacgcgtaacccg
gcagaaaaatcattgcctggctttaagaaagtaaaaccacaagtttatgcgggcctgttc
ccgataagctctgatgattatgaatctttccgggatgcgttaggtaagttaagtcttaac
gatgcctctttgttctatgaaccagaaagctctacagcattaggctttggtttccgatgc
ggcttccttggcttgttacatatggagatcatccaggagcgtctggagcgtgaatatgat
ctggaactgattactacggcaccaacagtggtgtacgaggtgattacgactaatcaggaa
acggtctatgtcgatagcccttctaaactgcctgcgttgaacaatattgaagaactgcgc
gaaccgatcgctgaatgccatatgttgttgccacaggaatacctcggtaacgtcattaca
ttgtgtatcgaaaaacgtggtacacagaccaatatggtttatcacggtaagcaagtcgcg
ctgacatatgaaattccaatggcggaagtcgtgcttgatttctttgatcgtttgaaatca
acgtcacggggttatgcttcactggattataatttcaaacgcttccagacgtctgacatg
gtacgtgttgatgtattaatcaataacgaacgtgtggatgcgctggcactgatcacgcat
cgtgataatgcacaatatcgtggccgtgatttggttgagaaaatgaaagaactgatccca
cgtcaacaatttgatattgcgatccaggctgcgattggtaaccacatcattgctcgctca
acggtaaaacagctacgtaaaaacgtattggcgaagtgttatggtggggatgttagccgt
aagaaaaaacttctgcagaaacaaaaagacggtaagaaacgtatgaagcaagtcggtaac
gttgaattaccacaagaggccttcctggctattctgcatgttggaaaagacagtaaataa

DBGET integrated database retrieval system