KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2725
Entry
YPO2725           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPO2725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO2725
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO2725
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-GeneID: 1175555
NCBI-ProteinID: YP_002347672
UniProt: Q0WDG6
Position
3055804..3058569
AA seq 921 aa
MSRTINLSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDL
KSLIGKEMTIEMELDGNGLGDVRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFY
LANLTSDFKIYQNKNVVDIIEEVFSDYNFPFEKRLATTYPILDFQVQYGETDFNFLQRLM
EEWGIYWFFEHQDHKQKLILVDHVGAHKRSFSTAYHAIEYLSDEPKAGEEYITQFQTQET
LTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHWPGDYDQPDIGEHLSRVRIEE
RGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSGGEDAFS
CESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGT
NSESDSCWLRVSQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWD
LPANATQSGMVSRTVGGGLTNYNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADS
VLNVGANRSEVVGANYNQDVLGTSMLAIGAASMLQVGLARSVVVGGAHSLNVVLANATNV
GGANMTNVGGFNGLAVGGAHQTAVGGAATLAAGGPIAIGAGGELILSGDIVKIVGKSKVI
IQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGAIALPLPLPLLPIVVPPVTSP
PDPTVPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP
PETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP
PETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP
PETTAPPEPTRTPPGTQTPPP
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgtcaaggacaataaatttgagcagcccggctatgccttatctattgggtgagcctgcg
ctggtactgtctaagttggaaggcgaggaagccttttcgactttatattcttatactatt
acggcaaagacaccggctaacccattaattccttggcaagcggcttcaaatgtcgatctc
aaatccttaattggtaaagagatgacgattgaaatggaactggacggcaacggcctgggt
gatgtgagaagtgtaggtaaaggcacgcgtgaaattacggggctggttgagagagccaga
tacattggtcgagatgccaatcaggccatatttgagatcactattaagccttggttctac
ctggctaatttaacctctgactttaaaatttatcaaaataaaaatgtcgttgatattata
gaggaagtgttctcagactataattttccgtttgagaaacggttggctacaacctatccg
atattagattttcaggttcagtacggtgaaaccgactttaatttccttcagcgtttgatg
gaagagtggggtatttactggttctttgagcatcaggatcataaacaaaaattaattctt
gtggatcatgtcggtgcgcataaacgctcgttcagtaccgcctaccatgccattgagtac
ttgtcggatgagcctaaagcgggcgaagagtacatcacacaattccagactcaggaaacc
ttgacgagtgggacctgggtcaccaacgattatgacttcacgaaatcccgtgccgatatt
ctggcaatggacagtaaaccgcgtaaaaccagctttaacgatctcgagatttatcactgg
ccaggggattatgatcagccagatattggtgagcacctttcacgcgtgcgtatcgaagaa
cgtggtgctctgggttcgcgggcggtcggttctggtcaactgcgcgggatagtttgtggt
gctaacttcgagctgaaagggttccccgttgataaagcgaatcgggaatacatgattatc
tccagccgtttgacggtggctgaagttgatcaactgtctggcggtgaggatgcgtttagt
tgcgagagttctttcacggttcagccgacgaccaaaatctatcgtcacccacaggtgaca
ccaaaaccgaaaaccaatgggccgcaaaacgccattattgtggggccaccgggtgaagag
atttggaccgatgaatatggccgcgtaaaagtgcgtttcgtttgggatcgctatggcaca
aacagcgagtcagactcttgctggctacgtgttagccaggcttgggcagggaacagcttt
ggtgggatctatattccacgcattggtcaggaagtcattgttgactgtattaacggcgat
cctgaccggccaatggtgatgggcagcctttataataacgtgacgcgtcccccttgggac
ctgcctgccaatgcgacgcaaagtggcatggtcagtcgtaccgttggcggcgggttaacc
aactataacggcgttcgttttgaagataaatcggggctggagcagtactgggaacaggcc
gagcgcgatatgtcgcgtttgactaaaaataatgaaacgcaaattatcggtgccgattct
gtcctgaatgtaggggccaaccgaagtgaagttgtcggggccaattataaccaagatgtt
cttggcacatcaatgttagccatcggtgcagcctctatgctacaggtgggattggcgcgt
agcgttgtggttggcggagcacattcactgaatgtggttttggcgaatgccaccaatgtg
ggtggcgctaacatgaccaacgtaggggggtttaatggccttgcggtggggggagcccat
cagacagctgtaggcggtgctgcgacactggctgccggcggccctattgctattggggcg
ggtggtgagcttatcctcagtggggatatcgtaaaaattgttggtaaaagtaaggttatt
attcagggcggtgaagttcacattaactctgatgattgttgtggtcgtaaaacgggcaat
ggcggcggggcattcggtgcctttgcgagcctggcaggtttattgccgctggcgggtgct
attgccttaccgctaccgttacccttgttgccaatagtggtgccaccagtgacatcgcca
ccggatccaacagtgccaccggatccgacattgccaccagatccaacgttgccaccagat
ccaacgttaccgccggaaaccacggcaccgccggaaaccacggcaccgccagaaacaacg
gcaccgccagagacaacggcaccgccggaaaccacggcaccgccggaaacaacggcaccg
ccagagacaacggcaccgccagagacaacggcaccgccagaaacaacggcaccgccggaa
acaacggcaccgccggaaacaacggcaccgccggaaacaacggcaccgccggaaaccacg
gcaccgccagagacaacggcaccgccagagacaacggcaccgccggaaacaacggcaccg
ccagaaacaacggcaccgccggaaacaacggcaccgccggaaacaacggcaccgccggaa
acaacggcaccgccggaaacaacggcaccgccagaaacaacggcaccgccggaaacaacg
gcaccgccagaaacaacggcaccgccggaaacaacggcaccgccagaaacaacggcaccg
ccagaaacaacggcaccgccggaaccgacgcgaacaccgccagggacgcagacgccaccg
ccttga

DBGET integrated database retrieval system