KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2934Help
Entry
YPO2934           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
KEGG Orthology (KO) [BR:ype00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO2934
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO2934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-GeneID: 1175755
NCBI-ProteinID: YP_002347863
UniProt: A0A384L768
Position
complement(3277633..3278982)
Genome map
AA seq 449 aa AA seqDB search
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLV
LRSGKGVLPDGTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSS
LARFYAYEAALNDTNAIRQGPKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSV
LLHTEDYIPPVTGYAASSLLSEWLTHLNGLVKMRAEMLANRLSNSDGKASASAEIVDYLL
LQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFIRTKTRRPRPAPGYDHAKLYA
SIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLVLAVHAQLPMD
VLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgagaactaacaaagtcgtttggagtgaggggctttttcttcgcccacaactttttcaa
cagcaagagcgctatcttgaatattacgcccataagcgagctgcaacgataaccccattc
ttttggggatttgcgcaatatgaaattgatagagaagcactctcgtatggcaaattagta
ttgcgatctgggaagggcgtgttacccgacggtacaccatttgatattcccggccatgct
gaattgcctgaaccgctcactatcaccccagaacatctgggtaagttgatctatctggcg
gtaccactgcgcctggataacagtgatgaaaccatttttgatgagcacgatatgagctca
ttggcacgtttttacgcctatgaagctgcgctcaacgataccaatgccattcggcaaggg
ccgaagccggtacaactgtcaagattacgtctcagattagtctcagaaggtgagatgaca
gaatcatggattgggctgccattaaccaaagtcagagcgattcagcctgatgggagtgtc
ttgctacacaccgaagactatattcctccggtgacgggttatgccgcaagttcattgctg
tctgaatggctaacccatcttaatggtttggttaaaatgcgcgcagagatgttggccaat
cgcttgtcaaacagtgatgggaaagcgagcgccagcgcagaaattgtcgattatttgtta
ctgcaaatttttaataaatatgagccgattctcgatcatttaaggcatattcctgaatta
ccgcctattacgctttatcaggaattggctaagttctcgggggaattatctacctttatc
cggaccaaaacccgccgaccccgcccggcacctggctatgatcatgcgaagctctatgcg
tctattcgtccgttggttgacgaagttcatgaactactgaaccagatcttggtgcgtgct
gggcagatgataccgctggagacgaaaggcaatggcgtttggtctgcctccgtactgcct
aatgaattacgctcgttttcaaatctggtccttgccgttcatgcgcaattaccgatggat
gtgctacagcatcaattttcagtacaaacaaaaatcagcgcacctcagcaattgcatgaa
ctggtgcgatcgcatttgccagggttggaactacagcgtttgccggtaccgcccagacaa
attccgtatagcgcagggtacgtttattttgaattgataaaaaatggccccttctgggac
aaagtttccaatgctggtgccattgccctgcatgtggcgggtgatttccctgccttgaaa
atggagctctgggggattagagattcatga

DBGET integrated database retrieval system