KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2935Help
Entry
YPO2935           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPO2935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO2935
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN DUF4969
Motif
Other DBs
NCBI-GeneID: 1175756
NCBI-ProteinID: YP_002347864
UniProt: Q0WCX4
Position
complement(3278986..3279546)
Genome map
AA seq 186 aa AA seqDB search
MILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPND
KGVANPLRIALYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTL
DAGVTAIGIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSI
SIKEMD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgattttaattaggctaagtatgaataaaagtatccgaggggtttaccgggcgacacag
tacttatttttggtactggtaacgttattgacgatagcctgtagttcaaaagtgcaacct
gaaaaggctgaaaagcttaccgtcgaaatcgcgacagcagcggatattaatccgaatgat
aaaggggtggcgaacccgctaaggattgcactttatacactcaagagcaccgatgaattt
cagtcgagtgatttcttcactatcactgaagaaaatacgccatcgctaaaagaacaaatg
gataacgtgtttgaccggattatgttgccaagcgagaccaaaaaaatagagctgacactt
gatgctggcgttactgctatcggcatcgtggctgcttatcgtgaaattgaacaggcggag
tggaaagcggttatttatccgttgcccaaaaaacgcgtggatccttggtataaaaaaatg
tggccagggcaagaccaacaagatccgatcatgaaggtacgcgttgagcgtctgtcaata
tcaattaaagaaatggattaa

DBGET integrated database retrieval system