KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3053Help
Entry
YPO3053           CDS       T00063                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00300  Lysine biosynthesis
ype01100  Metabolic pathways
ype01120  Microbial metabolism in diverse environments
ype01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    YPO3053 (dapE)
Enzymes [BR:ype01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     YPO3053 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 1175874
NCBI-ProteinID: YP_002347973
UniProt: Q7CJI9
Position
3410745..3411872
Genome map
AA seq 375 aa AA seqDB search
MICPVIELAQQLIKRPSLSPSDAGCQEIMIQRLAAIGFTIEPMNFGDTLNFWAWRGEGET
LAFAGHTDVVPTGDESHWHSPPFEPTIRDGMLYGRGAADMKGSLAAMIVAAERFVAAHPD
HKGRLAFMITSDEEAKATNGTVKVVEALMARHERLDYCLVGEPSSTDRVGDIVKNGRRGS
ITANLRIHGVQGHVAYPHLADNPVHRAMPALNELVATQWDEGNAFFPATSMQIANLQAGT
GSNNVIPGEFYVQFNFRFSTELTDSLIKQRVAALLDRHQLDYTLEWVLSGQPFLTAKGAL
VDAVVNAVKHYTEITPQLLTTGGTSDGRFIALMGAQVVELGPVNATIHKVNECVSAADLQ
LLSRMYQKIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtccggtaatcgaattggcccaacagttaattaaacgcccatcgctcagccct
tcagatgcgggttgccaagagatcatgatccagcgcctagccgccatcggctttaccatc
gaacccatgaattttggtgatacgcttaatttttgggcatggcgtggcgaaggcgaaacg
ctggcatttgctggtcacacggatgtggtgcctaccggtgacgagagccactggcacagc
ccaccgtttgaacccaccatccgtgacggcatgttgtatggccgaggtgccgcagacatg
aaaggctcactggcagcaatgatcgtagcagccgagcgttttgtcgccgcgcaccctgac
cacaaaggccgcctggcctttatgataacctccgatgaagaagccaaagccaccaacggt
acagtaaaagtggttgaagccctgatggcacgccacgagcggctggattattgtctggtg
ggcgaaccatccagtactgaccgggttggcgatatcgtgaaaaatggccgccgtggctcc
atcaccgctaacttgcgtattcatggagtgcaagggcacgtggcgtatcctcatctggcg
gataatcccgttcatcgtgctatgccagcgctgaatgaattggttgccacccaatgggat
gaaggcaatgcgtttttccctgccaccagtatgcaaattgccaatttacaggccggtacg
ggcagcaataatgttattcccggtgaattttatgtgcagtttaacttccgtttcagtact
gaactgactgacagcctgatcaagcaacgggtagccgcattgctggatcgacatcagctt
gattacaccctggaatgggtattgtctggtcaacctttcctgaccgccaaaggggcgttg
gtggatgccgtggttaatgccgttaagcattacactgaaatcacaccgcaactgttaacc
accggggggacgtcagatggccgctttattgcgttaatgggggcgcaagtggttgagttg
gggccagttaatgccaccattcataaagttaatgaatgtgttagcgcggctgatttacaa
ttgctcagccgtatgtaccagaaaatcatggaacaactgatcgcatga

DBGET integrated database retrieval system