KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3418Help
Entry
YPO3418           CDS       T00063                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00010  Glycolysis / Gluconeogenesis
ype00020  Citrate cycle (TCA cycle)
ype00620  Pyruvate metabolism
ype01100  Metabolic pathways
ype01110  Biosynthesis of secondary metabolites
ype01120  Microbial metabolism in diverse environments
ype01130  Biosynthesis of antibiotics
ype01200  Carbon metabolism
Module
ype_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPO3418 (aceF)
   00020 Citrate cycle (TCA cycle)
    YPO3418 (aceF)
   00620 Pyruvate metabolism
    YPO3418 (aceF)
Enzymes [BR:ype01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YPO3418 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA Ifi-6-16
Motif
Other DBs
NCBI-GeneID: 1176235
NCBI-ProteinID: YP_002348310
UniProt: Q7CKE5
Position
complement(3818758..3820287)
Genome map
AA seq 509 aa AA seqDB search
MSIEINVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDKVATGSLIMVFDATGAAAAPVKAEEKPAAPAQVAAPAASAAKNVEVPDIGDDEVEVT
EVMVKVGDKVDAEQSLITVEGDKASMEVPAPFAGIVKEIKISTGDKVKTGSLIMVFEVEG
AAPAPAAAPAAKAESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDI
QAYVKDAVKRAEAAPAAAGGGLPGILPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWV
MIPHVTQFDEADITEVEAFRKQQNIEAEKKKQDLKITPLVFLMKAAAKALEEFPRFNSSI
SEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKGIVELSRELSVISKKARDGKLTAS
DMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKEFAPRLMLPLSLSF
DHRVIDGAAGARFAAYIATIMADIRRLVM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagaaattaatgtaccagacatcggtgcagatgaagtggaagtcaccgaaatt
atggtgaaagtgggcgataccgttgaagcggaacagtcgctaatcaccgttgaaggcgat
aaagcttccatggaagttccttcacctcaggcgggcgtggttaaagagatcaaaattgcg
gttggcgataaagtggctaccggttctctgatcatggtcttcgacgctacgggtgccgct
gcggcaccggttaaagcagaagaaaaaccggcggcgcctgctcaggtagcggctccggca
gcctctgcggcgaaaaatgttgaagtgccagatatcggtgatgacgaagttgaagtgact
gaagtgatggtgaaagtgggcgataaagttgacgccgaacaatcactgattacggttgaa
ggcgacaaagcgtcgatggaagtgcccgcaccgtttgctggtatcgtgaaagaaatcaaa
atcagtaccggcgacaaagtgaaaaccggctctctgattatggtcttcgaagttgaaggt
gcagcgccagcgccagccgccgcacctgccgccaaagcagaaagcaaaggcgagtttgcc
gagaatgacgcttacgtgcatgccacgccggttatccgtcgtctggcgcgtgagttcggt
gtgaacctggcgaaggtgaaagggacaggccgtaagggccgtatcctgcgcgaagacatt
caagcttacgtgaaagatgccgtgaaacgtgccgaagctgcaccagcagcggctggcggc
ggcctgccgggcatattgccttggccaaaagttgatttcagtaaatttggtgaaatcgaa
gaagtcgaattgggccgtatccagaaaatttctggtgcgaacctgagccgtaactgggtc
atgatcccacatgtgacgcaattcgatgaagcggatatcactgaagttgaagccttccgt
aagcaacagaacatcgaagctgagaagaaaaaacaagacctgaaaatcaccccgctggtg
ttcctgatgaaggccgccgctaaagcactggaagaattcccacgctttaacagctccatt
tccgaagatggtcagaaactgacgctgaagaaatacatcaatatcggtgtggcggttgat
acgcctaacggcttggtagttccagtattccgtgacgtcaacaaaaagggtattgtcgag
ttgtctcgtgagctatctgtcatctccaagaaagcacgtgatggcaagctgacagcatct
gacatgcaaggcggctgtttcactatctccagtctgggcggtatcggcggtacggcattt
acgccaatcgtcaatgcgccagaagtggctatcttgggtgtatcaaaatcatccatgaaa
cctgtctggaatggtaaagagtttgctccacgcctgatgttaccgctgtctctgtccttc
gatcaccgtgtgattgatggtgccgcgggtgcacgcttcgccgcgtatatcgctaccatt
atggcggatattcgccgtctggtgatgtaa

DBGET integrated database retrieval system