KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3555Help
Entry
YPO3555           CDS       T00063                                 

Gene name
arcB
Definition
(RefSeq) aerobic respiration control sensor protein ArcB
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YPO3555 (arcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ype01001]
    YPO3555 (arcB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ype02022]
    YPO3555 (arcB)
Enzymes [BR:ype01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     YPO3555 (arcB)
Protein kinases [BR:ype01001]
 Histidine kinases
  OmpR family
   YPO3555 (arcB)
Two-component system [BR:ype02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   YPO3555 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HKR_ArcB_TM Response_reg PAS PAS_4 Hpt HisKA PAS_9 HATPase_c_3 PAS_8 CCB1
Motif
Other DBs
NCBI-GeneID: 1176375
NCBI-ProteinID: YP_002348442
UniProt: A0A384KVQ8
Position
complement(3962788..3965124)
Genome map
AA seq 778 aa AA seqDB search
MKQIRVLAQYYVDLMVKLGLVRFSLLLASALVLLAMVVQMAVTFVLRGSVETLDLVRSIF
FGLLITPWAVYFLSVVVEQLEESRQRLSRLVDKLEVMRHRDLELNKQLTENITQLNQEIV
EREKAEKAHLQVVDKLKEEMGHREQAQIELGQQSALLRSFLDASPDLVYYRNEDNEFSGC
NRAMELLTGKSEKQLVGLTPKDVYAPDIAEKVMETDEKVFRHNVSLTYEQWLVYPDGRKA
CFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASRDKTTFISTISHELRTPLNG
IVGLSRILLDTELDAEQLKYLKTIHVSAITLGNIFNDIIEMDKLERRKVQLDNQPVDFTG
FMADLENLSGLLVQPKGLKFIMEPQLPLPEKVIADGTRLRQILWNLIGNAVKFTQQGKIV
VRVRREGNDRLIFEVEDSGMGIPEDEQDKIFAMYYQVKDRNGGRPATGTGIGLAVSKRLA
QSMGGDITVKSTQGVGSCFTLTIKAPAVQEASNAPSGDDMPLPALHVLLVEDIELNVIVA
RSVLEKLGNSVDVAMNGHDALAMFNPEDFDLVLLDIQLPDMSGLDIARQIRAEYGKQSLP
PLVALTANVLKDKKEYLDAGMDDVLSKPLSVPALTAMIKQFWDSKPSSAVQKQEHKVMQT
HESLLDTTMLEQYIDLVGPQLIHQSLEMFEQMMPGYLAVLDSNMTARDQKGITEEAHKIK
GAAGSVGLRHIQQLAQQIQTPTLPAWWDNVQDWVDELKLEWRNDVQVLREWAAEVEKK
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaatccgggtattagcccagtactatgttgatttaatggttaaattagggctg
gtgcgtttttcgctgctactggcatcggcattggtgttattggcgatggttgttcaaatg
gccgtcaccttcgtcttgcgcggctctgttgaaaccctcgatctggtgcgctccattttc
tttggtttgctgataaccccttgggccgtgtatttcctgtcggttgtggttgagcaactg
gaagagtcgcgccagcgcctgtcccggttggttgataagctcgaagtgatgcgtcatcgc
gatctcgagctgaacaagcaactgacagaaaatattactcaactgaatcaagagattgtt
gaacgcgaaaaagcagagaaagcgcatctgcaagtggtcgataaactgaaagaagagatg
ggccaccgcgagcaggcgcagattgagctggggcagcaatcggccttattacgttctttt
ctcgatgcttcgccagatttggtttattaccgtaacgaagataatgagttttccggttgt
aaccgcgcaatggaattgttgacgggtaaaagtgagaagcaactggtcggattgacgcca
aaagatgtttatgcaccagatatcgccgagaaagtgatggagaccgatgagaaagtcttc
cgccataacgtttctcttacctacgaacagtggctggtttacccagatggccgtaaagcc
tgttttgaactgcgtaaagtgcctttttatgaccgagtcggtaaacgacatgggctaatg
ggctttggacgcgatataaccgagcgtaagcgctaccaggacgcgctggagaatgccagt
agggataagacgacatttatctcaacaatcagccacgagctacgtacgccgcttaatggc
attgttggcctcagtcgcatcttgttagataccgaattagatgccgaacaactgaaatac
ctaaaaaccattcatgtcagtgctatcactcttggaaatattttcaacgatatcattgaa
atggataagctggagcggcggaaagtacagcttgataatcaacctgttgattttactggg
ttcatggccgatctggaaaacctctccggtttactggtgcagccaaaaggattgaaattc
attatggaaccgcagttgccattgccggagaaagtgattgccgatgggacccggctgcgc
caaatcctgtggaacctgattggtaatgcggtgaaattcacccagcaaggcaaaattgtg
gtgcgggtacggcgtgagggtaacgaccgcctgatttttgaagtcgaagattcaggcatg
gggataccggaagacgaacaagataaaattttcgccatgtattatcaggtgaaagatcgc
aacggggggcgcccggccacgggcaccggtatcggcctcgcggtatctaaacgtctggca
cagagtatgggcggtgatattacggtgaaaagcacgcagggggtgggttcttgcttcacc
ttaaccatcaaggcacctgcggtacaggaagcctccaacgcgccgtcaggcgacgatatg
ccattacctgctcttcatgtactgctggtggaagatatcgagctgaacgtcattgttgcg
cgttcagttctggaaaaattggggaacagtgttgacgtggcgatgaatggccacgatgca
ttagccatgtttaaccctgaagattttgatttggttttattagatattcagttgcctgat
atgagtgggctggatatcgcccggcaaattcgggcggaatatggcaagcagtcattgccc
ccgttggtcgcattaaccgctaacgttcttaaagataagaaagaatatttagatgccggc
atggacgacgtgctgagtaagccactgtcagtccctgcactgacggccatgattaagcaa
ttttgggatagtaagccctcttcagcggtacaaaaacaggagcataaagtgatgcaaacc
catgaatcgttacttgataccaccatgttggaacaatacatcgatttagttggcccacag
ttgattcaccaaagtctggagatgtttgaacagatgatgccaggttatttggcggtgctg
gattcaaatatgacggcgcgggaccaaaaggggatcacggaagaagcacacaaaattaaa
ggggcggcaggttctgtcggtttacgccacatacagcaactggcccaacagattcagaca
ccgacattgccagcgtggtgggataacgtgcaggactgggtcgatgagttaaaattagaa
tggcgtaatgatgttcaggtattgcgtgagtgggcagcggaagttgaaaaaaaataa

DBGET integrated database retrieval system