KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3598
Entry
YPO3598           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPO3598
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO3598
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO3598
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-GeneID: 1176418
NCBI-ProteinID: YP_002348483
UniProt: A0A5P8YK81
Position
4006106..4006873
AA seq 255 aa
MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLGMVLRLKDMENQALPD
QLYQQVVTDIRAIEQYLQTKGYEPGAIISFRYVLCTFIDETALGHGWNTQNGWLQQSLLV
HFHNETWGGEKVYVLLERLMGEPKRYQDLLEFIYLCFCLGYRGRYKVTSQNGDDFERLFR
RLHHQLQQLRGDAPPTVLYQGGGRLNSRYHLSKRLTIKHLLWGGVSLLVVIYLFYAIHLH
TQSQDILQQLNNLLS
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaaaacagatgctgtgactgacaacacccctttccccgcagcggaagcggtcacctcc
catcggcagtatcagctaccgctacgtggcgaaagcttgaacgcgatgatcgataccgcc
accccattattggggatggtactgcgcctgaaagacatggaaaaccaagcgttaccggac
cagctatatcagcaggtggtgacggatatccgtgctattgagcagtacttgcaaaccaaa
ggctacgaacccggcgcaatcatatctttccgatatgtgctgtgcacattcatcgatgaa
acggcattagggcatggctggaacacccaaaacggttggttacagcaatctctgttggtg
cattttcataatgaaacctggggcggagagaaagtgtacgtcctgctggaacgcttaatg
ggggaacccaagcgttaccaagacctgctggagtttatctatctctgtttttgtttgggt
taccgcggccgctacaaagtgacatcacaaaacggtgatgactttgagcgattgttccgc
cgattgcatcatcaattacagcagttacggggtgatgcgccgccgacggtcctttatcaa
gggggcggtcgtctgaatagccgctaccacttgagtaaacggttgactatcaagcatttg
ttatggggtggcgtgagtctgctggtggtgatttatctgttttatgccatccacctgcac
acccaaagtcaggatattttgcaacagctaaacaatttattgagctag

DBGET integrated database retrieval system