KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3603
Entry
YPO3603           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPO3603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO3603
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO3603
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C MMR_HSR1
Other DBs
NCBI-GeneID: 1176423
NCBI-ProteinID: YP_002348488
UniProt: A0A380PHL3
Position
4012390..4015923
AA seq 1177 aa
MKLPFFIRIAKPAIPRLKASIPVVLALMACAALIWVWIYGPEWQLGENYPFETLLSRWLV
TAVFVLVAVCWLSLKVMRRVQHLEKLQLQTKIQLDDPVSADIEQQNHYLNGWKHQLQRHL
NTPEYLYRLPWYMVIGARNSGKSTLIKEGYKLTEISASERLHAEDAADLRVRCWLGEQAV
IIDPAGVLIEQPTTPIAGKASLNSRLWQSLLSWLIEQRQRQPLNGIILTVDLHQMMTANK
AQRETYVADIHQRLQEIRLSLHSQVPLYVVFTKMDLLYGFEAMYQSLDKAEREAVLGVTF
SLNAADPDVWRTELKQFWQQWVAQLNGAMPDMMLNSVDAGQRSQLFSFTRQMQGLHDYVV
QLLEGILYRGEHAQPLLRGVYLTSAQQRGQMDDIFTQSAAVQYHLAPQAFPTWPVSDTTP
YFTKALFNQVLLAEPNLAGENGIWLQKTRKRMFIFSGVGALAALTLWGYWHYYHQLNYRA
GEEVLTQAKTFLSIPPPEGDDRYGNLQLPLLNPIRDATLAYGNYHERSPFLADMGLYQGN
NIGPYVESTYLQLLQQRFVPALMSGLLEQLNAAPKGSEEKLEILRVMRMLEDGSGRNAAL
VEQYMSHRWSQQFNGQRELQEQLSSHLNYALKHTDWHGARESGDQYAIKSFVPYLRPIQS
AQQELSKLSIYQRVYQNLRIKAQDALPPALDLRDQIGASFDDIFVSGNDRLLVIPQFLTR
SGLQSYFIKQNDQLVDLTVMDSWVLNLTKNVEYSEADRKEIHRQVTEQYLGDYTATWRAA
MNNLSVSDFEGLPQAISAIEQVISGEQPFRRALQTLSDNTRLPVISDLIPAKEQQELLQK
PDYLLLTRINREFSPETAVLVENGDKGSVIQSVYQKLTELHRYLLAIQNSPAPGKAALKA
VQLRLDQNNSDPIFEVQQLAKNLPEPLNRWVGELAEQAWRVVMMEAIQSLEVEWNETVIK
QYQTYLAGRYPFDPHAKQDVPLSEFERFFGPKGTLDAFYQQNLKPFVENNLTGGSDGELL
IRPDVLQQLAQARKIRDTFFSAQNGLGTQFAIEPVLLSGNKRRSVLNLDGQLLDYAHGRS
GVVHLVWPNSMRAGVESKLTLVPDESGKSPRTLSFSGPWAQLRLINAGELTNVGTNSFDV
RFKVDGGEMTYRIFVDESDNPFAGGLFSKFSLPDTLY
NT seq 3534 nt   +upstreamnt  +downstreamnt
atgaaattgccgttctttatacgcatagccaagcccgccattcctcgccttaaagcgtca
ataccggtggtattggcgttgatggcttgtgcggcactcatttgggtatggatttacgga
cccgagtggcaattgggggaaaattacccgtttgagacattattgagccgttggttggtc
acggcggtatttgtcttggtggccgtttgttggctcagcctgaaagtcatgaggcgagta
caacacctggaaaaactccaactgcaaacgaaaattcagctcgacgaccccgtcagtgct
gatatcgagcaacaaaaccactacctcaatggctggaagcaccaacttcagcgccatttg
aacaccccggaatatctgtatcgcctgccctggtacatggtcattggtgcgcgcaatagc
ggcaaaagtacactgatcaaagaagggtataaactgacagagatctccgcatccgagcgg
ctccatgcggaagacgcagcagatctgcgcgtccgctgctggttgggggaacaagcggtt
attatcgatcctgcgggggtgctgattgaacaacctacgacaccgatcgcgggcaaagca
tcactcaacagccgcttatggcaaagtctattatcctggctgattgaacagcgccagcgt
cagccgctaaacggcattattctcaccgtcgatcttcatcagatgatgaccgcgaataaa
gcgcagcgggagacttacgtcgctgatattcatcaacggctgcaagagatacggctgtct
ttgcacagccaggtgccgctgtatgtggtgttcaccaaaatggacctgctgtacggcttc
gaggccatgtaccaatcgctggataaagccgaacgtgaagcggttctgggggtgacgttc
agcctcaatgcggcggatccggacgtgtggcggacggagttgaaacagttctggcagcaa
tgggtcgcacaactgaatggcgcgatgccggacatgatgctgaacagtgtggatgccggg
cagcgtagccagttgtttagcttcactcgccagatgcagggcctgcacgattacgtcgtg
caactgctggaaggcattctgtaccgtggagaacatgcccagccgctgttacggggggtt
tatctcacgtctgcccagcaacgcgggcaaatggacgatatctttacccaatctgccgcg
gtgcaatatcaccttgcgccacaggccttcccgacctggccggtctcggatacgacgccg
tattttaccaaagcgctgtttaaccaggtgctattggccgaacccaatctggccggagag
aacggtatctggctgcaaaaaacgagaaagcgaatgttcattttctcgggggtgggtgcc
ctggccgcgctgaccttatggggctactggcactactatcaccagcttaactaccgggct
ggcgaagaggtattaacccaggcaaaaaccttcttatcgatcccaccgccagaaggcgat
gaccgttatggcaatctgcaactgccgctgctaaaccccatccgtgacgccacgctggct
tacggtaattaccatgaacgcagcccgttcctggcggatatggggttatatcagggcaat
aatatcgggccttatgtcgaaagcacttacttgcaactcctacagcaacgttttgtcccg
gcactgatgagcgggctgttagaacaactgaacgccgcgccgaagggcagtgaagagaaa
ctggaaattctgcgggtgatgcggatgttggaagacggcagtggccgcaatgccgcgctg
gttgaacaatatatgagccaccgctggagccaacaattcaacggccagcgcgagttgcag
gagcaactgtcgagccacctgaactacgcactgaaacacaccgactggcacggcgcacgg
gaaagtggcgatcaatatgcgatcaagagctttgttccgtacctccgcccgatccagtca
gcgcagcaagagttgagcaaactctcgatctaccaacgggtgtatcagaacctgcggatc
aaagcacaggatgcgttgccgcccgcgctcgatttgcgcgatcagatcggcgcaagtttt
gacgacatctttgtctccggtaacgatcgcctgctggtgatcccgcaattcctgacccgt
agcggcttacagagttacttcatcaaacagaacgatcaactggttgatctcacggtgatg
gacagttgggtacttaatctcaccaagaacgtcgaatacagcgaggcagaccgcaaagag
atccatcgccaggtgaccgaacagtatcttggcgattataccgccacctggcgtgcggct
atgaataacctgtcggtcagtgattttgaaggcttgccacaggcgatcagcgccattgaa
caggtgatcagcggggaacaacctttccgccgtgcactgcaaacgctgagtgacaacacc
cgcttgccggttatctcggatctgatccccgcgaaggagcagcaagagctgctgcaaaaa
cccgattacctgctgctgacccgcatcaaccgtgagttctcccccgaaacggcggtgctg
gtggagaatggcgataaaggcagcgtgatccaaagtgtttaccaaaaactgaccgagcta
caccgctatctgttggcgatccaaaactcgcccgcgccgggcaaagcggcgttgaaggcg
gtgcaattacgtctggatcaaaacaacagtgatccgatttttgaagtccagcaactggct
aaaaacctgccggagccgctaaaccgttgggtgggcgaactggcagagcaagcctggcgg
gtggtgatgatggaggcgatccagtcactggaagtggagtggaatgagacggtgatcaaa
cagtatcaaacctacctggccggacgttatcccttcgatcctcacgcgaaacaggatgta
ccactcagtgagtttgaacgcttcttcgggccgaaaggcacgctcgatgcattctatcag
cagaacctgaaaccgtttgtcgaaaacaacctgaccggtggcagcgatggcgaattgctg
atccggcctgatgtgttacagcaactggcgcaggcacggaaaattcgcgacaccttcttc
tcggcccaaaacggcctgggcacacagtttgcgattgaaccggtgctgttaagtggcaac
aagcgccgcagcgtattgaatctggatgggcaattactggattacgcccatggccgcagc
ggcgtagtgcatctggtttggccaaactcgatgcgtgcaggagtggaaagcaaactgacg
ttagtcccggatgagagcggcaaatcaccgcgcaccctcagcttcagcggtccttgggcg
cagttgcggctgatcaacgccggtgaactgaccaatgtgggcaccaactccttcgatgtc
cgcttcaaggttgatggcggcgagatgacgtaccgcatctttgttgatgaatccgacaac
ccattcgcgggcggtttgttcagtaaattcagtctgccagacactctgtattga

DBGET integrated database retrieval system