KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3606
Entry
YPO3606           CDS       T00063                                 

Definition
(RefSeq) Rhs accessory genetic element
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPO3606
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO3606
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Ribosomal_L5e
Other DBs
NCBI-GeneID: 1176426
NCBI-ProteinID: YP_002348491
UniProt: A0A3N4AZ01
Position
4017382..4019784
AA seq 800 aa
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALDAKAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALEAKAKVLDGGVTPMNLAAGGAGAGLPDSAAAAISRLVKQPSGLQFTLTTASL
PPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGM
VASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFG
FRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLP
YNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGP
PGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDF
LHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFM
HAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSNTIQNDRRVEVTRDQQTEVGN
DYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNAGITITHDGAI
VLQGKYIRLAADMIDLNPEE
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaagccgcggacaagaccggcacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atggccggggggattggggatgcggtgggcggcactgccggtaagcgcatcaatcaggcc
gccgaggtggcaaaaaccgccctggatgccaaagcaaaagtactggacggcggcgtcacg
ccgacgaacattgtggccactggcccggccccaaccgtgagtggcgctcaaatgaccgag
atggccggggggatcggggatgcggtgggcggtactgccggtaagcgcattaatcaggcc
gccgaggtggctaaaaccgccctggaggccaaagcaaaagtactggacggcggcgtcacg
ccgatgaatctggccgcgggcggggccggtgcgggattgccggacagcgccgcggcggcg
atatcccgcctggtcaaacagccctccggcctgcaatttaccctgacgacggccagttta
ccgccccagacctttgcggtggtggatttcaccctgagcgagatgctctcctcgccgttt
gtgctcaatgtcgggctggcgagtgccgatccggcggtggattttgcggcggtattggat
gaagacgccacgctgtttatctggcgcgaaggggtactgcaacgcagcatcaccggcatg
gtcgccagctttgaacagggcgataccggttttcatcagacccgctacagcatggtgatc
cgcccggcgctgtggcgcaccagcctgcggcgcaatgcccgcatcttccagcaagcctcg
gtggaagagatcatcaccaccctgctgaaagagaacggcatcaacgattttgcttttggt
tttcgccacccgcacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgat
tttatccagcgcctgacggcagaagaggggattttctactacttcgagttcagcgccggg
aaaaataccgtggtgtatgccgatgatgttggctccctgccgaaaggcgcgtcactgccc
tataacccgaatgtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagt
gcgcaggtgcgcccggcgatggtgcaactgaaagactacacctttaaaaacccgaactgg
gccgcggccttcagcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcat
tttgattttccggggcgcttcaaagatgcccagcacgggcaggattttacccgctaccgg
ctggacgcgctgcgcaatgacgccaatctggggcagggggccagcaatgattttaccctc
cagccggggcagttgttcagcctgtacaaccacccgcgtggtgatctgaaccacgcctgg
cagttgctcggtattcagcacagcggcaaacagatgcaggcgctggagcaggcatctggc
gatcagggcacggtgctgttcaaccacttcagttttattccgcacacccagacctggcgg
ccgacgccgttggctaaaccggcgatggacggcccgcagatcgccatggtggtggggccg
ccgggggaagagatttactgcgacgaatacggccgcatccgcctgcaatttttatgggat
cgctacgggcagagcaatgacaacagctcctgttggatccgggtaacccagccgtgggcg
ggccagggctggggcatgctggccattccgcgtattggtcaggaagtggtggtggatttt
ctgcacggcgatccggatcaaccgattgtcacggggcggacctatcacgccaacaacatc
ccgccggggtcgttaccggccagtaaaacccagatggcgttccgctcaaaaacccacaaa
ggggaaggctacaacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatg
catgcgcagaaagatatgacgaccatggtgctgaatgatcgcaaaaccgatgtgactcag
gaccattcagagcacattgggcaagatcagtccgtgacggttgtgcgtaaccaaagtaat
acgatccaaaatgatcgccgggtagaggtgactcgcgatcaacaaaccgaagtgggcaat
gattaccagctagtggtgaaaggtgaaaagaaagagtttgtgacgaaaattcgttacacc
gaagtgcatgaagacgaaacgctcacggtgacgaaaagtattaaaatccatgccaaacaa
ggtgatatcagcatatcaaccccgaatgccggaattacgatcacccatgacggtgccatt
gttctgcaagggaaatacattcgtttagcggccgatatgatcgatcttaatccagaggag
tag

DBGET integrated database retrieval system