KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3613
Entry
YPO3613           CDS       T00063                                 

Definition
(RefSeq) Rhs accessory genetic element
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPO3613
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO3613
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO3613
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C gpW
Other DBs
NCBI-GeneID: 1176433
NCBI-ProteinID: YP_002348498
UniProt: Q0WB40
Position
4026381..4028579
AA seq 732 aa
MFAHDKANNNKTADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALDAKAKVLDGGVTPLNLAAGGAGAGLPDSAVAALTRLVKQPSGLQFTLTTASL
PPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGM
VASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFG
FRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLP
YNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGVQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGP
PGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDF
LHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHQGEGYNEMRFEDAKGGEGLFM
HAQKDMSTTVKDNQTTTVEKGNQTVTVEKGDRTVTVATGNETTDITQGSLTETIKVRRST
CANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDSIILQFSGSTSITLNAANIDA
IAPLINLNKDKG
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaaaccgcggacaagaccggcacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atggccggggggattggggatgcggtgggcggcactgccggtaagcgcattaatcaggcc
gccgaggtggctaaaaccgccctggatgccaaagcaaaagtcctggacggcggcgtcacg
ccgctgaatctggccgcgggcggggccggtgcgggattaccggacagcgccgtggcggcg
cttacccgcctggtcaaacagccctccggcctgcaatttaccctgacgacggccagttta
ccgccccagacctttgcggtggtggatttcaccctgagtgagatgctctcctcgccgttt
gtgctcaatgtcgggctggcgagtgccgatccggcggtggattttgcggcggtgctggat
gaagacgccacgctgtttatctggcgcgaaggggtgctgcaacgcagcatcaccggcatg
gtcgccagctttgaacagggcgataccggttttcatcagacccgctacagcatggtgatc
cgcccggcgctgtggcgcaccagcctgcggcgcaatgcccgcatcttccagcaggcctcg
gtggaagagatcatcaccaccctgctgaaagagaacggcatcaacgattttgcctttggt
tttcgccacccgcacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgat
tttatccagcgcctgacggcagaagaggggattttctactacttcgagttcagcgccggg
aaaaataccgtggtgtatgccgatgatgtcggctccctgccgaaaggcgcgtcactgccc
tataacccgaatgtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagt
gcgcaggtgcgcccggcgatggtgcaactgaaggactacacctttaaaaacccgaactgg
gccgcggccttcagcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcat
tttgattttccggggcgcttcaaagatgcccagcacgggcaggattttacccgctaccgg
ctggatgcactgcgcaatgacgccaatctggggcagggggcgagcaatgattttaccctc
cagccggggcagttgttcagcctgtacaaccacccgcgtggtgatctgaaccacgcctgg
cagttgctcggcgttcagcacagcggcaaacagatgcaggcgctggagcaggcgtctggc
gatcagggcacggtgctgttcaaccacttcagttttattccgcacacccagacctggcgg
ccgacgccgctggcgaaaccggcgatggacggcccgcagatcgccatggtggtggggcca
ccgggggaagagatttactgcgacgaatacgggcgcatccgcctgcaatttttatgggat
cgctacgggcagagcaatgacaacagctcctgctggatccgggtaacccagccgtgggcg
ggccagggctggggcatgctggccattccgcgtattggtcaggaagtggtggtggatttt
ctgcacggcgatccggatcaaccgattgtcacggggcggacctatcacgccaacaacatc
ccgccggggtcgttaccggccagtaaaacccagatggcgttccgctcaaaaacccaccaa
ggggaaggctacaacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatg
catgcgcagaaagatatgagtaccacggtaaaagataaccagacgacgacggtggagaaa
ggtaatcaaaccgtcaccgtagaaaaaggtgacaggacagtcacggtcgcgaccggaaat
gaaaccacagatattacccaagggagcctgaccgagacgatcaaagtgcgtcgcagtacc
tgcgcgaattttattcaggtgaaggctgaaggtgatgcgcctggtacgcaactttatacc
gcgacggaacagataaagttcgtggtgggcaagagcagcattaccttaaatccggactct
attattctgcaattttctggctctacctctattacgctgaatgccgccaatattgacgcc
atcgcgccattgattaacttaaataaagacaagggataa

DBGET integrated database retrieval system