KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3708Help
Entry
YPO3708           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ype00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPO3708
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ype02044]
    YPO3708
Secretion system [BR:ype02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPO3708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-GeneID: 1176527
NCBI-ProteinID: YP_002348589
UniProt: A0A0H2W8A5
Position
4142000..4142518
Genome map
AA seq 172 aa AA seqDB search
MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFEHIVTVPTDPQSGQPS
GQRAHKPLRFTVAYNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATI
IDIDCKMPHCQDSTKAEFTQLVRVSLAYRKINWDHTTAGTSGADDWRAPIEA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccaactccagcttatatctctatcacagggaaaacgcagggcaatattaccgcaggt
gctttcacagctgaatccgtcggtaatatctatgttcaaggtcatgaagacgaaatgttg
gtacaggagtttgagcacattgtgacggtgcctaccgatcctcaatccggccagccttcc
ggccaacgtgcgcacaaaccattgcgtttcactgttgcgtacaacaaagccgttccattg
ctgtataacgcattagcctctggtgaaatgctgccaacagtggaattgaagtggtaccgc
acctcgattgaaggcaaacaagagcatttcttcacgactaaactggaagatgccaccatt
atcgacattgattgtaaaatgccgcattgtcaggattccaccaaggctgagtttactcaa
ttagtccgtgtatcactggcataccgcaagattaactgggatcacaccaccgcgggcacc
tctggtgctgatgactggcgtgcgccgatcgaagcgtaa

DBGET integrated database retrieval system