KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3960Help
Entry
YPO3960           CDS       T00063                                 

Definition
(RefSeq) hypothetical protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00010  Glycolysis / Gluconeogenesis
ype00030  Pentose phosphate pathway
ype00051  Fructose and mannose metabolism
ype00680  Methane metabolism
ype01100  Metabolic pathways
ype01110  Biosynthesis of secondary metabolites
ype01120  Microbial metabolism in diverse environments
ype01130  Biosynthesis of antibiotics
ype01200  Carbon metabolism
ype01230  Biosynthesis of amino acids
Module
ype_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ype_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ype00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPO3960
   00030 Pentose phosphate pathway
    YPO3960
   00051 Fructose and mannose metabolism
    YPO3960
  09102 Energy metabolism
   00680 Methane metabolism
    YPO3960
Enzymes [BR:ype01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     YPO3960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase FMN_dh
Motif
Other DBs
NCBI-GeneID: 1176799
NCBI-ProteinID: YP_002348831
UniProt: Q0WA57
Position
complement(4457252..4458112)
Genome map
AA seq 286 aa AA seqDB search
MALISLANGLAHARKNGYALGAFNVLDSHFLRALFAAAKQERSPFIINIAEVHFKYLSLE
SLVEAVKFEAAHHDIPVVLNLDHGLHFEAVVRALRLGFSSVMFDGSTLEYEENVRQTREV
VKMCHAVGVSVEAELGAVGGDEGGALYGEADSNKFTDPAIARDFVDRTGIDALAVAIGNA
HGKYKGEPKLDFARLAAIHQQTGLPLVLHGGSGISDTDFRRAISLGIHKINFYTGMSQAA
LAAVEQKMTHRHAIYDEFAELFLGIEEAITDVVAQQMRIFGSSEQI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggctttgatttcccttgcaaatggcctggctcatgccaggaaaaacggttacgcattg
ggtgcctttaacgtgctcgatagccactttttgcgcgccctgtttgccgctgcaaaacag
gaacgatcgccgtttatcatcaatattgctgaagtccattttaagtacctttcgctagaa
tcattggtagaagcagtgaaattcgaagctgcacaccatgatatcccggtggtgcttaat
ctcgaccacggcctgcactttgaagccgtggttcgcgcactcaggctgggttttagctcg
gtaatgtttgatggttccacgcttgaatatgaagaaaacgttcgccaaacccgtgaagtt
gtgaagatgtgccatgccgtgggtgtatcggtagaagctgaactgggcgctgttggcggt
gatgaaggcggcgcgctttatggtgaagctgatagcaataaattcactgatcccgctatc
gcccgggactttgttgaccgtaccggtatcgatgccttagcggtcgccatcggcaacgca
cacggcaagtataaaggtgaacccaagctcgacttcgcgcgtctggccgccattcatcag
caaaccggcctacctctggtactgcacggtggctctgggatcagcgataccgatttccgg
cgggctatcagccttggcattcataaaatcaatttttataccggcatgtcgcaggcagcg
ctggctgccgtggaacagaaaatgactcatcgacacgctatttatgacgagttcgccgag
ttgttcctggggatcgaggaggctattactgatgtcgtagcgcaacaaatgcgaattttc
ggcagttcagagcaaatctga

DBGET integrated database retrieval system