KEGG   Yersinia pseudotuberculosis PA3606: BZ19_1016Help
Entry
BZ19_1016         CDS       T03846                                 

Definition
(GenBank) methylaspartate ammonia-lyase family protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
ypf  Yersinia pseudotuberculosis PA3606
Pathway
ypf00051  Fructose and mannose metabolism
ypf01100  Metabolic pathways
ypf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BZ19_1016
Enzymes [BR:ypf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     BZ19_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: AJK14545
Position
1166199..1167476
Genome map
AA seq 425 aa AA seqDB search
MTIITALRTEDVRFPTSLELDGSDAMNPDPDYSAAYVILDTDNPALSGHGLTFTIGRGNE
ICCVAIHALEHLIVGRDLASMTANMGKFWREFTSDSQLRWIGPEKGAIHLATGAVINAVW
DLWSKAEGKPLWRLVADMSPEELVRCIDFRYITDCITPEEALTLLQQRAHNKALRLEKLQ
DEGYPCYTTSAGWLGYPDDKLRRLCQDAVDAGFDYLKLKVGRDLEDDIRRVRITREVLGP
DRKLMIDANQIWETNEAIPWVNQLAFANPWFIEEPTNPDDIEGHRRIRQGVAPVKVATGE
MCQNRIMFKQFIMREAIDVVQIDACRLGGVNEVLAVMLMAAKYDLPVCPHAGGVGLCEYV
QHLAMIDYLCIAGTDKGRVIEYVDHLHEHFVHPCVIKNAAYMPPEQPGFSIEMHQSSIEK
YRFRV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacaataatcactgcattacgcactgaggatgtacgttttcccacctcgttggaattg
gatggctcggatgcaatgaatcccgatcctgactattcagcagcctatgtgattttagac
accgataatccggcactcagtggccacggtctgacgttcaccatcggacgtggtaatgaa
atttgctgcgtggccatccatgcattggaacatctgatcgttggccgtgatttagcatca
atgactgccaatatgggcaagttttggcgtgaatttaccagcgacagccagttacgttgg
atcggtccggagaaaggcgcgattcatctggccactggcgcggtaatcaatgccgtatgg
gatttatggagtaaggcggagggcaagccgctgtggcgtttagtggccgatatgtcccct
gaagagttggtgcgctgtattgattttcgctacatcaccgactgtattaccccggaggag
gcattaacgctgttgcagcagcgagcgcataacaaagccctacggctggaaaaattgcaa
gacgaaggctacccttgctataccacgtctgcgggctggttggggtatcccgatgataag
ttacggcgcttatgtcaggacgcggtggatgccggttttgactatttgaaactcaaagtg
gggcgtgatctcgaagacgatattcgccgggtgcgcattacccgtgaggtgcttggtcct
gatcgtaaactgatgattgacgccaatcagatctgggaaactaacgaggctattccgtgg
gtgaatcagctcgcgtttgccaatccgtggtttattgaggaacccactaacccggatgat
atcgaaggccatcgtcgtattcgtcaaggtgttgctccggtcaaagtggcaacgggcgaa
atgtgccagaaccgcattatgttcaaacaattcatcatgcgcgaagccatcgacgtggtg
caaatagatgcctgccggttaggcggggtcaacgaagtgttggcggtaatgctgatggcg
gcaaaatacgatctgccagtgtgtccacatgccggtggtgtcgggttatgtgagtatgtg
caacacctggcgatgattgattatctgtgtattgccggaacggataaagggcgagtgata
gagtatgtcgatcacttacatgagcattttgttcacccgtgtgtgattaaaaacgcggcc
tatatgccacccgagcaaccgggtttctccatcgaaatgcatcaatcgtcgatagagaag
taccgttttcgcgtttaa

DBGET integrated database retrieval system