KEGG   Yersinia pseudotuberculosis PA3606: BZ19_3887Help
Entry
BZ19_3887         CDS       T03846                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ypf  Yersinia pseudotuberculosis PA3606
Pathway
ypf00564  Glycerophospholipid metabolism
ypf01100  Metabolic pathways
ypf01110  Biosynthesis of secondary metabolites
Module
ypf_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ypf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BZ19_3887 (psd)
Enzymes [BR:ypf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BZ19_3887 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: AJK15357
Position
complement(4449234..4450115)
Genome map
AA seq 293 aa AA seqDB search
MLDSIKIKLQYLLPKQGLTQLAGWGANKQGGWLTQLVIKAFARYYKVDMKEAQDPEFSAY
RTFNEFFVRPLRAGVRPVVAEENLLAQPADGAISQLGAIREGQILQAKGHNYSLEALLAG
NYLLAAEFQNGQFVTTYLAPRDYHRVHMPCDGVLREMIYVPGDLFSVNPLTAANVPNLFA
RNERVICIFDTAFGPMAQILVGATIVGSIETVWAGTITPPREGVIRRWTYPQAGCEGAIT
LEKGQEMGRFKLGSTVINLFAEGKVYFAPQLNSGAVTRMGEVLAEAVPTTPSY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgctagacagtatcaaaattaaactacaatatttacttccgaaacaagggctaacacaa
ctcgctggctggggagcgaataagcaaggcggctggttgacccagttagtcatcaaagct
tttgcccgttattacaaggtcgatatgaaagaagcgcaggatcctgaattctccgcttat
cgtaccttcaacgaattctttgttcgcccgttacgcgcaggtgtacgcccggttgtggct
gaagaaaacctgttagcccaacctgccgatggcgcaataagccagttaggggccatccga
gaggggcaaattttacaggcgaaaggccataattacagtctggaagccctattagccggt
aactatctgctggctgctgaattccaaaatgggcagtttgttaccacttacctggccccc
cgagactaccaccgggtgcatatgccatgtgatggtgtgctacgcgaaatgatttatgtg
ccgggggatttgttctcggtcaatccgttaaccgctgccaatgttcctaatttgttcgcc
cgtaacgaacgcgttatttgtatctttgataccgcctttggcccaatggcccaaattctg
gtgggtgcgaccattgttggcagtatagagaccgtctgggcggggacaattaccccccca
cgggaaggcgttatccgccgttggacatacccgcaagcaggctgtgaaggggctatcacc
ctagagaaaggccaagaaatggggcgttttaaattaggctcaaccgttattaacctgttt
gcggaaggtaaagtgtatttcgcaccacagctaaacagcggcgcggttacccgtatgggt
gaagtcttagccgaagcggttcctactaccccttcttactag

DBGET integrated database retrieval system