KEGG   Yersinia pseudotuberculosis PA3606: BZ19_791Help
Entry
BZ19_791          CDS       T03846                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ypf  Yersinia pseudotuberculosis PA3606
Pathway
ypf00260  Glycine, serine and threonine metabolism
ypf01100  Metabolic pathways
ypf01110  Biosynthesis of secondary metabolites
ypf01120  Microbial metabolism in diverse environments
ypf01130  Biosynthesis of antibiotics
ypf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BZ19_791
Enzymes [BR:ypf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BZ19_791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJK14572
Position
complement(889235..890254)
Genome map
AA seq 339 aa AA seqDB search
MLIDLRSDTVTQPCAAMRAAMANAEVGDDVYGDDPTVNALEAKAASLSGKEAALFLPTGT
QANLVALLTHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLSLDNVLAA
IKPDDIHFAPTRLLSLENTHNGKVLPLRYLQQAWALTREKKLALHIDGARVFNAAVALNV
PLNDISQYCDTLTICLSKGLGTPVGSLLCGSAEFIHRARRWRKMTGGGMRQAGILAAAGL
YALQHNVARLKDDHDNAQWLEQQLRDLGIEIAAPGAQTNVLYITQSAESALKLGPWMRER
GVLISAGPLTRLITHLNVSRKDLEKVVALWREFIAEQHS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgatttacgcagtgacacagtaacgcaaccctgtgccgccatgcgcgccgcg
atggcgaatgccgaggtcggcgatgatgtgtatggcgatgacccaaccgtcaatgcgctt
gaagccaaagccgccagtttatccggtaaagaagccgcgctgtttctgccaacaggcact
caggcaaatttggtggcgctattgacccattgtcagcgtggtgaagagtatattgtcggc
caaaaagcccataactatttgtatgaagccgggggtgccgccgttttgggcagtatccaa
ccacaacctattgatgccaacgatgacggcaccttatcactggataacgttctggccgcc
atcaaacccgatgacattcactttgcccccacccggctgttaagtttggaaaatactcac
aatggcaaagtcttgcctttgcgttatttacagcaagcctgggcgttgacccgcgagaaa
aaactggcgttacatattgatggtgcacgtgtttttaatgctgcggtggcgctgaatgtg
ccactgaacgatattagccagtattgcgataccctgacaatttgtctgtcaaaagggtta
gggacgcctgttggttccctgctctgtggcagcgcagaattcattcatcgcgcccggcgc
tggcgaaaaatgaccggtggtggtatgcgtcaggccggtattttagcggcagccgggttg
tatgcgctgcaacataatgtggcgagactcaaagatgatcacgataacgcccagtggttg
gagcagcaattacgtgacttaggcattgagatagccgcccccggcgcgcaaacaaacgtg
ctgtacattacgcaatctgccgaatcagcgttgaaacttggcccctggatgcgtgaacgt
ggtgtgctgatcagtgccgggccgctcacccgcctgattactcaccttaacgtgagccga
aaagatctggaaaaagtcgtcgcgctgtggcgtgaatttattgccgagcaacattcatga

DBGET integrated database retrieval system