KEGG   Yersinia pestis Angola: YpAngola_A2376
Entry
YpAngola_A2376    CDS       T00635                                 
Name
(GenBank) bacteriophage lambda tail assembly protein I
Organism
ypg  Yersinia pestis Angola
SSDB
Motif
Pfam: Lambda_tail_I
Other DBs
NCBI-ProteinID: ABX88558
Position
complement(2495389..2496009)
AA seq 206 aa
MTLFAQEVMTPIKLSGSLAKMFGRDHQRLVGSSGEVIKALCVTIPGFEQYLMTAKQRGLT
FAVFKNKRNVGKDELELASGGQEIRIVPVIIGSKRGGLFQTILGVALIGMATFMSGGLAV
AFGAGGVWGGAMAMMGASMALGGVIQMLSPQQSGLAMRQSPDNKPSYAFGGPVNSTAQGN
PVGVLYGKRRIGGAVISAGIYAEDQM
NT seq 621 nt   +upstreamnt  +downstreamnt
atgactttatttgcgcaagaagtaatgacaccaatcaaactaagcggttcattagctaag
atgttcggtcgcgaccatcaacgattagttggtagctctggcgaagttattaaggcttta
tgcgtaactattcctggctttgagcaatacctgatgacggctaagcagcgtggactcacg
tttgctgtattcaaaaataagagaaatgtcggcaaggatgagttggagcttgcaagtggt
ggacaagaaattcgtattgttcctgtaattatagggagcaaacgcggtgggctgttccag
accatactcggcgtagctttaatcggtatggcaacatttatgagtggaggcttggcggtg
gcgtttggcgcgggtggagtatggggtggtgcaatggcaatgatgggcgcatccatggcc
cttggcggcgttatccaaatgctatcaccgcagcagagtgggttagccatgaggcaatca
ccagacaacaagccaagctatgcattcggcggcccggttaactctacggctcagggtaac
ccggtgggcgtactctacggcaagcgtcgaattggcggggcggttatctcggcgggtatt
tatgctgaagatcaaatgtaa

DBGET integrated database retrieval system