KEGG   Yersinia pestis Angola: YpAngola_A0337Help
Entry
YpAngola_A0337    CDS       T00635                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00520  Amino sugar and nucleotide sugar metabolism
ypg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YpAngola_A0337 (nagA)
Enzymes [BR:ypg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     YpAngola_A0337 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ABX88276
Position
complement(350990..352135)
Genome map
AA seq 381 aa AA seqDB search
MYALTHGRIYTSHEVLDNHAVVVADGLIERICPVDELPAGIEICDLGGAILAPGFIDVQL
NGCGGVQFNDSLEAISAETLDIMQRANEKSGCTSFLPTLITCSDEFMKHGVDVMRSYLQK
NQHQALGLHLEGPYISPLKKGTHNPAFIRKPSAEMIDYLCANADVITKLTLAPEMVDPKY
IQQLTEAGILVSAGHSNATYQQARQGFTAGIRFATHLYNAMPYISGREPGLIGAIFDTPE
VYTGVIADGLHVDWANIRNAKRLKGEKLVLVTDATAPAGAKIEQFIFAGKTIYYRDGLCV
DENGTLSGSALTMIEAVQNSVEHVGIALDEALRMATLYAARAIGVDKQLGSIEVGKVANL
TAFTRDYKITKTIVNGNEVLS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacgctttaactcacggccgtatttataccagccatgaagtactggataatcatgct
gttgtcgttgctgatggattgatcgaacgtatctgtcctgtcgatgaacttccggctggt
attgagatatgcgatttgggtggtgccattctggcccccggttttatcgatgttcagctc
aatggctgcggtggtgtgcagttcaatgactctctcgaggctatctcagcagagacgttg
gatatcatgcagcgagccaatgaaaaatcaggttgtaccagcttcctacccacactgatt
acctgcagcgatgaatttatgaagcacggcgttgatgtcatgcgttcatatctgcaaaaa
aaccagcatcaggcgctcggcttgcaccttgaaggcccttatatcagcccactgaagaaa
ggcacccacaacccggcctttatccgtaagcccagcgctgaaatgattgactatctgtgt
gccaatgccgatgtgatcaccaaactcactctggcacctgaaatggttgatcctaaatat
atacagcagctcacagaagcaggtattttggtttctgccgggcactcaaacgcaacctat
cagcaagcccgtcaagggtttaccgccggtatccgatttgcgacccacctttataatgca
atgccgtacatttcggggcgtgaaccgggccttattggggccatttttgatacaccagag
gtatacacaggcgtgattgccgatggcctgcatgttgactgggccaatattcgcaatgct
aagcgcctaaaaggcgaaaaactggtgctggtaaccgatgccactgcgcctgccggtgct
aaaattgaacaatttatttttgctggcaaaacaatatactatcgcgatggtttatgcgta
gacgaaaatggcacattaagcggttcggcactaaccatgattgaagcggtgcaaaacagt
gtcgaacatgtcggtatcgcgctggatgaagccctgcgtatggcaacactttatgcggcc
cgcgccattggcgtggataaacagttaggaagtattgaagtcggcaaagttgccaacctg
actgcctttacccgcgattataaaatcactaaaaccatcgttaatggcaacgaggtttta
tcataa

DBGET integrated database retrieval system