KEGG   Yersinia pestis Angola: YpAngola_A0364Help
Entry
YpAngola_A0364    CDS       T00635                                 

Gene name
pdxB
Definition
(GenBank) erythronate-4-phosphate dehydrogenase
  KO
K03473  erythronate-4-phosphate dehydrogenase [EC:1.1.1.290]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00750  Vitamin B6 metabolism
ypg01100  Metabolic pathways
Module
ypg_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YpAngola_A0364 (pdxB)
Enzymes [BR:ypg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.290  4-phosphoerythronate dehydrogenase
     YpAngola_A0364 (pdxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C DUF3410 2-Hacid_dh F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABX85406
UniProt: A9R7V0
Position
complement(377433..378560)
Genome map
AA seq 375 aa AA seqDB search
MKILVDENMPYAEELFRRLGDVQAVPGRPIPRDALVDADALMVRSVTKVNEALLHGTSIG
FVGTATAGTDHVDDTWLRQQGIGFSAAPGCNAIAVVEYVFSALMMMAERDGFQLRDKTVG
IIGVGNVGSRLNARLQALGVRTLLCDPPRADRGDNEAFWPLEKLVREADVLTFHTPLNKT
GAYQSLHMADDELLAALPDGRILINACRGAVVDNAALLRALEKGKKLSVVLDVWEPEPDL
SLPLLARVDIGTPHIAGYTLEGKARGTTQVFEAFSQHLGQPQSVELASLLPVPEFSHLRL
NGELDEGKLKRLMHLVYDVRRDDAPLRHVAGLPGEFDRLRKHYQERREWSSLCVQCDDAT
SAGLLQQLGFTTQLL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattctggttgatgaaaatatgccgtacgctgaggagctgttccggcgtttaggt
gatgtacaggctgtgccagggcgtcccattcctcgtgacgcgttggttgatgccgatgct
ctgatggtacgttcggtcaccaaagtgaacgaggcgctgctacacggtacctcaattggt
tttgttggcacggcgacggcgggtaccgaccatgtcgatgacacttggctgcgtcagcag
gggatcggtttctctgcggcccccggttgtaacgccatcgccgtggttgaatatgttttc
tctgcgttgatgatgatggctgaacgggatggcttccagttgcgcgataaaaccgtgggc
attatcggcgtcggaaatgtgggttcacggctgaatgctcgtttgcaagccttaggtgtt
cggaccttgttgtgcgaccccccgcgtgctgatcgtggtgataacgaagccttctggccg
ctggaaaaactggtacgtgaggctgacgttctgaccttccatactccgctgaataaaacc
ggagcctaccaaagtctgcatatggccgatgatgaactgctggccgccttaccggatggc
cgtattctgatcaacgcctgccggggtgcggtggtggataacgcagcactattacgggcg
ctggaaaaagggaaaaaactcagcgtggtattggacgtctgggagccagaaccggatctc
tctttaccgctgttggcccgtgtcgatattggcacaccgcatattgccggatatacgcta
gaaggcaaagcacggggtaccacacaggtttttgaggcgttcagtcagcatttggggcaa
ccacagtcggtcgaactggcctctttattgccagtgccagagtttagccatttacgtcta
aatggtgagttggatgaaggcaaattaaaacgattgatgcacttagtgtatgatgtgcgc
cgcgatgacgcgccattgcgccatgtcgctggcctgccaggggagtttgaccgcctgcgc
aagcattatcaggagcggcgtgaatggtcatcactgtgtgtacagtgcgatgatgctacc
agtgctggactcttgcagcagctaggttttactactcaattgctgtga

DBGET integrated database retrieval system