KEGG   Yersinia pestis Angola: YpAngola_A0589Help
Entry
YpAngola_A0589    CDS       T00635                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ypg  Yersinia pestis Angola
Pathway
ypg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YpAngola_A0589 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ypg03011]
    YpAngola_A0589 (rplV)
Ribosome [BR:ypg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    YpAngola_A0589 (rplV)
  Bacteria
    YpAngola_A0589 (rplV)
  Archaea
    YpAngola_A0589 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733
Motif
Other DBs
NCBI-ProteinID: ABX86285
UniProt: A9R901
Position
607867..608199
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgcttggta
gcggacctgattcgcggtaagaaagtgtcgcaagctctggaaactctaacctacaccaac
aaaaaagctgctggtttggttaagaaggtactagagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtcacgaagatcttcgtagacgaaggccct
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system