KEGG   Yersinia pestis Angola: YpAngola_A0763
Entry
YpAngola_A0763    CDS       T00635                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ypg  Yersinia pestis Angola
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypg02044]
    YpAngola_A0763
Secretion system [BR:ypg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpAngola_A0763
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABX87786
Position
complement(778332..778892)
AA seq 186 aa
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDR
KFLTFDQDNFDARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQM
EKLLEARTHLAELITYMDGKTSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVE
DDDGEK
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccaaagatgcgagctcgcaaaaatttatcggtagaaataatgcacctagagtgcaa
attgaatatgacgtcgaaatttatggttcaaataagaaagtagagttgccttttgtaacc
ggcgtgatggctgatctttctggccacagagcaaagcctcttcctgctgttgaagatcgt
aaattccttactttcgatcaggataatttcgatgcccggatgagagcaattaagcctcgc
cttaaattctacgtagataacaccttgagtgaggataacgaactcctggatatcgaactg
gattttgagtcaatggatgacttttcccccggatcgttagcgcggcgtattcctcaaatg
gaaaaactgcttgaggcacgcacccatctggctgaattgatcacctatatggatggtaaa
accagcgcagaagaggtggttaaacaactgcttgaacaacctgattttttacaaaatctt
gcgaccgatgcacagggaactatttcgaagctcagccaggatgatgatgttttagtggaa
gatgacgatggagaaaaatag

DBGET integrated database retrieval system