KEGG   Yersinia pestis Angola: YpAngola_A0824Help
Entry
YpAngola_A0824    CDS       T00635                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00760  Nicotinate and nicotinamide metabolism
ypg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YpAngola_A0824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ypg03000]
    YpAngola_A0824
Enzymes [BR:ypg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     YpAngola_A0824
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     YpAngola_A0824
Transcription factors [BR:ypg03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    YpAngola_A0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_19 HTH_31 HTH_26 CTP_transf_like Citrate_ly_lig MMR_HSR1 HTH_37 AAA_16 FAD_syn HTH_35 ABC_tran AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ABX85483
Position
complement(846710..847981)
Genome map
AA seq 423 aa AA seqDB search
MLQFDYLKTAIKQKGCTLQQVAEASGMTKGYLSQLLNDKIKSPSAQKLEALHRFLGLEFP
RREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHVILCHDEPRDRELFENSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHSFDEHGIEPYPHGWDVWSRGVKAFMNEKGIVPSFIYSSES
QDAPRYREQLGIETILIDPQRSFMNISGRQIRRDPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGREYVFSHLGGDEMALQYSDYDKIALGQAQYVDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SDRDRKSFQNLLEQMLRDNNIEYVHVESADYDARFLRCVELVQQLLAADPQRLARPSVLT
DAR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagttcgactatctcaaaacggcaattaagcaaaaaggctgcaccttacagcag
gtggctgaggccagcggcatgaccaaaggctatttaagccagctacttaacgataaaatc
aaaagccccagtgcgcaaaaattagaggccttacaccgttttctcgggttggaattcccg
cgccgtgagaaaaaagtcggtgtagtgtttggtaaattttaccctctgcataccggtcat
atttatcttatccagcgcgcctgtagccaggtcgatgaactgcacgtcattctttgccac
gatgagccgcgtgatagggagttgtttgagaacagttcgatgtcgcaacaacccacggtc
agtgaccgcctacgttggttgttacaaacctttaaatatcagaaaaatatccacattcac
tcttttgatgagcacgggattgagccttatcctcacggttgggatgtgtggagccgtggc
gtaaaagctttcatgaatgaaaagggtattgtccccagctttatctattccagcgagagt
caggatgcgccgcgttaccgagagcaactgggtatcgaaaccattttgattgacccgcag
cgctcatttatgaacatcagtggccgccagatccgccgcgatcctttccgctattgggat
tatatcccgactgaagtcaaacccttctttgtgcgcacggtagccatcctcggtggcgaa
tccagtggtaaatcgacgctggttaacaagttagccaatatcttcaataccaccagtgcg
tgggaatatggccgtgagtatgtcttctcccatctggggggcgatgagatggcactgcaa
tattcggactatgacaaaattgcgctggggcaggcgcagtatgtggattttgctgtgaaa
tacgccaataaagtggcgtttattgatactgatttcgtcaccacacaggcattttgtaag
aaatatgaagggcgggaacaccccttcgttcaggctctgattgatgaataccgttttgat
ctggtgatcttattggaaaataataccccgtgggtggcagatgggttgcgtagcctcggt
agtgaccgcgatcgaaaatccttccaaaatttactcgagcagatgttgcgcgacaataat
attgaatacgttcatgtcgagtcagccgattatgacgcccgcttcctacgctgcgttgaa
ctggttcagcaactgctggccgccgatccgcaacggcttgcccgcccttcagtattaacg
gatgcgcgataa

DBGET integrated database retrieval system