KEGG   Yersinia pestis Angola: YpAngola_A1907Help
Entry
YpAngola_A1907    CDS       T00635                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00860  Porphyrin and chlorophyll metabolism
ypg01100  Metabolic pathways
ypg01110  Biosynthesis of secondary metabolites
ypg01120  Microbial metabolism in diverse environments
Module
ypg_M00121  Heme biosynthesis, glutamate => heme
ypg_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YpAngola_A1907 (hemB)
Enzymes [BR:ypg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     YpAngola_A1907 (hemB)
Exosome [BR:ypg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YpAngola_A1907 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABX87261
Position
1979631..1980653
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGTFPGRRMRRVRCHDFSRRLVAENHLTVNDLIYPVFVMEGTHQQQAVSSMPGVS
RMTIDLLLKEAEAIAKLGVPVISLFPVIEAGKKSLYAEEAYNPDGLVQRTVRALKDAVPE
LGILTDVALDPYTTHGQDGVIDSDGYVINDVTKEILVRQALSHAEAGAEIIAPSDMMDGR
IGAIRDQLERQGLVNTQIMAYSAKYASCYYGPFRDAIGSSSNLKGGDKKTYQMDPANSDE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEKPTVMESLLCFKRAGADGVLTYFAKQVAQWLHDDQMQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccgggcacctttcctggtcgccgtatgcgccgtgtacgctgtcat
gatttcagccgccgtttggttgccgagaatcacttgacggtcaatgacttgatttacccg
gtgtttgtcatggaagggactcaccagcaacaagccgtttcttcaatgccgggggtctct
cgtatgacaattgatctgctgctgaaagaagcagaagcaattgctaagctcggtgtgccg
gttatatcgctattcccggtcattgaagcagggaaaaaatcattatatgcagaagaggca
tataacccggatggtttagttcagcgtactgtgcgtgcgttgaaagatgcagttcctgag
ctaggtattctgactgacgtggcactcgatccctatacgacccatggtcaagatggtgtg
attgattctgatggttacgtgatcaatgatgtcaccaaagagattctagtgcgtcaggca
ctatcgcatgctgaagctggcgctgagattattgcaccaagcgatatgatggatggccgt
ataggtgcaattcgtgatcaattagagcgccaagggttagtgaacacccagataatggct
tattcggctaagtatgcgtcttgctactatggcccattccgcgatgcaattggctcgagc
agtaatctaaaagggggggataaaaaaacttatcagatggatcccgccaacagtgatgaa
gcactgcaagaaatagctcaagatttacaagaaggcgctgatatggtgatggtaaaacca
ggaatgccatatctggatgttgtacgcagggtgaaagatacttttggtgttccaaccttt
gcctatcaggtgtctggtgaatatgccatgcatatggcagcgattcagaatggctggctc
caagagaaaccgacggtgatggagtcgttgttatgctttaagcgtgcaggtgcggatggc
gtattaacttatttcgcaaagcaagttgcgcaatggctacatgatgaccagatgcagcgc
taa

DBGET integrated database retrieval system