KEGG   Yersinia pestis Angola: YpAngola_A1933
Entry
YpAngola_A1933    CDS       T00635                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ypg  Yersinia pestis Angola
SSDB
Motif
Pfam: PAAR_motif
Other DBs
NCBI-ProteinID: ABX85450
Position
complement(2002910..2003170)
AA seq 86 aa
MFSAAKMGDVTSDGGAICTGSCDVFINNIPASKLGSGATSTLVGLTALVTGSGTVFINNC
PATRCSDKTGCGSVIVTGSPNVFIGN
NT seq 261 nt   +upstreamnt  +downstreamnt
atgttcagtgcggcaaaaatgggcgatgtgaccagcgatggtggtgcgatatgtaccggt
tcatgcgatgtgttcattaacaatattccggcctctaagctgggttcgggcgcaacgtct
acgttggtaggcctgacggcgctggtaactggctctggaacggtatttatcaataattgt
cccgcgacgcgttgtagtgataagacggggtgtggctcggttattgtcactgggtcgccc
aatgtatttataggtaactaa

DBGET integrated database retrieval system