KEGG   Yersinia pestis Angola: YpAngola_A1937
Entry
YpAngola_A1937    CDS       T00635                                 

Gene name
icmF
Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
ypg  Yersinia pestis Angola
Pathway
ypg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YpAngola_A1937 (icmF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypg02044]
    YpAngola_A1937 (icmF)
Secretion system [BR:ypg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpAngola_A1937 (icmF)
SSDB
Motif
Pfam: IcmF-related_N IcmF-related Colicin_V
Other DBs
NCBI-ProteinID: ABX88656
Position
complement(2007918..2011370)
AA seq 1150 aa
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLL
ILGFWYGAPRFVIAAVVACAAVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTW
CLVKALAKNPALLDNFIKHKKAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFI
SNRWRTELPWFMVVGMKGAGKTALILSSGQDFPLPEQLNRIGKENPPTQHCECLFSNDAL
FLDTSGKYIDDSKDNQTEWTGILKALKKYRPVKAINGVIVAISASDILGKSKADLLNVSA
TLRTRLDEVRAVLGVRFPVYVTITKLDQISGFDEYFRNLTAEDREQIWGVTFPYNEAKEQ
SDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQN
VFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQK
SDNEDRFISDVAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAV
WLVWAFLVSFQHNEGYLQATGAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLD
VANPELDWRYGLYTGSAISQGANTLYQFFLQKYLFPMVENQSEVTLRKTMHSGQSEEVYA
ALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKSIFVGHLNTLFTLKDWRQYGQ
PADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHATQVFTLSDDEL
LHEGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQ
GYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLA
EKEKAITDEINIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADV
TGGNNLSVLQGTQMSRIIGTLNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDP
FRNIIAPLLTGSSQKFENKVITHTSKAIDMGVGEICRNTLQGRYPFAESEQIVSLNDFER
FFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAFFEQAAMIRNVLFNTNDGKKM
ALDEPVHNSV
NT seq 3453 nt   +upstreamnt  +downstreamnt
atgtcttatttgaatcgattgttttctggctgggccatgaaacgcatattgctggtcggc
tgctttatattgctggctgcggcgatatggtttctggggcctttcctcggctttggtgag
gcgcggcctctcgaaagttatgaagccagaattatttgcatcctgctggcactgctgctg
atcttaggtttttggtacggcgcaccgcgctttgtcattgccgccgtcgttgcctgtgct
gcggtatgggtgattggcccattcatattagttggtgatgatcatcctctgactgatggg
atccgtcgcggcatcattatcgccatcattgcatttattacacttatttatggcacctgg
tgcttagtcaaagcattggcgaaaaatccagcgttactggataacttcattaagcacaag
aaagcggccaagcctgaagcggaggctgaactttctgaagttaatgcgatgatccgcaat
ggcatgaactatgtgcgccgtattcacagtggtattccggcctggcgacgtttctttatc
tccaaccgttggcgcacagaactgccttggttcatggttgtcggtatgaaaggtgcaggg
aaaaccgcccttatcctctcttcaggacaggactttcctttacctgagcagctgaatcgt
attggcaaagaaaacccacccactcaacattgtgaatgtttgttctctaatgacgccctg
tttttagacacttcagggaaatacattgatgacagcaaagataatcagactgagtggacc
gggatattaaaggcactcaaaaaatatcgtccggttaaggcaattaatggtgtcattgtt
gcgatttcggcatccgatatcttgggtaaaagtaaagctgatttactgaatgtgtcggcg
acgctacgcacgcgtttggatgaggtacgtgcggtcttgggcgtccgtttcccggtgtat
gtcacgattacaaaactggatcaaatatcgggttttgatgaatatttccgtaatttaacg
gctgaagatcgcgagcaaatttggggggtgactttcccttataacgaggcgaaagagcaa
tccgatatgccacttcagcaacgtatcagccatgagctggcactgcttgaggatcgtatc
agcaataatatgcacgtccgccagcaggaagagtatgccgtggcggacagaaaaggcatg
tatgcactccctcaggatttcaggatgctctcccagagggtaacggaagttttacagaat
gttttcttcgcctcacgctttgacgaaacaaaatttcacacgaccctgagagggatctat
tttgtcagcagttgtcagcctgcggatgttgaactgttaaataacaacacgctgattcaa
aagtggcgtaacgttattaatcataaaaaaccgttatcgccagccgatttatcacaaaaa
agtgataatgaagatcggtttattagcgatgtggcttacgggaaacaatatttcctcaag
cagttgtttagcgatgtgattaccaaagatgccgacttagtcagctataacctgaaagta
caatccaaataccgttttcagaatctattgggacacgcggcttgtattgggttggcagtt
tggctggtttgggccttcttggtcagcttccagcataacgaggggtatttacaggcgacc
ggtgccaagctgagtcagttagaaagcacggtgatgagttatgccaaaacgtccaatgag
cagatcttacctgcgttattgaacgcgacacagcagttacccgagtacggtacgctggat
gtggctaaccctgagcttgactggcgttatggcttatataccggtagcgcaatctcacaa
ggtgcgaacacgctctatcagtttttcttgcaaaaatatctcttcccaatggttgagaat
cagagtgaggttacattaagaaaaacgatgcactcaggtcagagcgaagaggtttatgcc
gcgctgaagctttatttgatgctgacgggtgaaggtaaatttgatcgtcaatatatgatt
gagcacgtgacccaagattggcagaaaagtggaaaaattgagccttacgaagagaagagt
attttcgtcggtcatttgaacacgctgtttaccctgaaagactggcggcagtatgggcaa
ccggcagacagtgaactgattaagcaggctcgggcaatactggcggaaaaaacagtgacc
gccagactttgggggcgtattcaatcccgcttattggccgatgcccctgccaatatgacg
ttacgtaaaatggtgggtgagcacgcgacacaggtattcaccctgtcagatgatgaacta
ctgcatgaagggatcccggggctttatacctacgcgggctaccatgaggtggttaaaaaa
aaactgacacctttgctgatgttacttcaggaagaggataggtgggtgatggcgcaatcg
ctgtcatcttctcttgaccccctgacgttaagacaagatgttctggtgatgtatttacaa
gggtatgccgcttattggaaacgctttctctccagtgttcgtctgatttctgtcgatgcg
gacagtgcagagtatgctcaagggctgtctctggatattgctttgttaaggacgttagtt
tcagaaaattcaccgctactcaatttagccaggcaggcggtaaaagaaacgacactcgcc
gaaaaagaaaaagccattactgatgagataaacatcagaacgcaagggcaattactcagc
caggctaaaaaattacaagaaacgatcgcgtttcgtgaaaataaactgattaaagagtgg
gttgataatcgttttgaatccctgagagtctttgttaatggggaacagagtgctgatgtc
acggggggcaataatctttctgttcttcagggaacgcagatgagccgaataatcgggaca
ttaaacgatcaatatacccgttttgttgtttataacagtgcctttgaatatggcgatatt
cctccgttatcccaggatggggaacgtattgcggtggaatcacaaacatggccggatccg
tttagaaatattattgcaccgttattaacgggctcatcccagaaatttgaaaataaagtg
attactcacacgtccaaagcgattgatatgggggtgggggaaatttgccggaatacgctg
caagggcgttacccatttgctgaaagtgagcaaattgttagtttgaatgattttgagcgt
ttcttcggtactgacggtacggtggacagttatttcaagaaaaacttggagagtaaagtc
gacacgtcctcaataccttggcgttataagggcagcgtaagtagtgaaggtttggcgttc
tttgaacaggcggcaatgatcagaaacgtgctatttaataccaatgacggtaaaaaaatg
gcattagatgagcctgtccataattctgtgtaa

DBGET integrated database retrieval system