KEGG   Yersinia pestis Angola: YpAngola_A1938Help
Entry
YpAngola_A1938    CDS       T00635                                 

Definition
(GenBank) SciP protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ypg  Yersinia pestis Angola
Pathway
ypg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YpAngola_A1938
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypg02044]
    YpAngola_A1938
Secretion system [BR:ypg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpAngola_A1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA DotU
Motif
Other DBs
NCBI-ProteinID: ABX86168
Position
complement(2011379..2012215)
Genome map
AA seq 278 aa AA seqDB search
MGRWWRYKWITFHPSLTYADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQS
TRDTIPPALSPHGLIAHQNRRRRGIFVPVRVSMLLCGFLIVATFIGCKYFLSVPESDLLK
RMGALQRVVVTPPVAAPKLRLSILLKDEIAKQLVSVDETSNNSKVIFKGDSMFMVGSDNV
RPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPNNQVLSEKRAANVARYMEQAG
IPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgttggtggagatataagtggatcacttttcatccgtcgttgacatatgcggat
ggtttagaggttttgctgcgcattttagggctcggttttgaggggcgctacagcattatc
gaagatggtgatcggcaattaactaaaatacgccaagggttgctgacgctgctccaaagt
acccgagacacgatcccaccggcactttctccgcatgggttgatcgcacatcaaaacaga
agacggcggggcatttttgttccggtgcgcgtatccatgctgttgtgtggtttcctcatt
gtcgcgacctttattggatgtaaatactttctctcggtaccggaaagtgacttgctaaaa
agaatgggagcattgcaacgtgtggttgtgacgccacccgttgccgcaccaaaacttcga
ctgtctattttattaaaagatgagatagcgaagcagttagtcagtgttgatgaaacgagc
aacaacagcaaagtcatctttaaaggcgactctatgtttatggtcggctcggataacgtc
agacctgaaatgattgacgtaattaaacgcgtcgcgcaggaagtgcatcgcgttaaaggg
gcaatcctcatcgtcgggcatacagactctatgccgattaataaacccggcttccctaat
aaccaggtactttccgaaaaacgcgcggccaatgttgcacgctatatggagcaggccggt
attccaaccgacaaaattcggtttgagggcaagggggaaacgcaaccggttagcagcaat
gacgatgcgacaggacgttcgcaaaaccgccgcgtagaaatttttgttaattattga

DBGET integrated database retrieval system