KEGG   Yersinia pestis Angola: YpAngola_A2463Help
Entry
YpAngola_A2463    CDS       T00635                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00900  Terpenoid backbone biosynthesis
ypg01100  Metabolic pathways
ypg01110  Biosynthesis of secondary metabolites
ypg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YpAngola_A2463 (ispE)
Enzymes [BR:ypg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     YpAngola_A2463 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF1127
Motif
Other DBs
NCBI-ProteinID: ABX88567
UniProt: A9QZ11
Position
2582148..2583047
Genome map
AA seq 299 aa AA seqDB search
MTTANQPICPSPAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQ
IRLLTPIAGVENEQNLIVRAAKMLQKHPGNTPVPRGADISIDKCLPMGGGLGGGSSNAAT
VLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQPAEPVEKWYLVI
HPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYA
PSRLTGTGACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRSGKIESSERR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcgaatcaacctatatgtccgtcaccagcaaaatggccgtcaccggcaaaa
ttgaatttgtttctttatatcaccgggcaacgcgccgacggctatcatcagttacaaacg
ctgtttcaatttcttgattatggtgatcaactgacgattgaaccgcgcgatgacaaccaa
attcgcttattaacccccatagcaggggtggaaaatgagcaaaacctgatcgtccgcgcg
gcaaaaatgctgcaaaaacaccctggcaatacccccgtgccacgcggtgctgatatcagc
attgataaatgtttaccgatgggcggtggattggggggcggttcgtctaatgcagccaca
gtcttggtggcactcaacctactgtggcaatgtggtttaactgatgaacaattagccgat
ctcggactaacattaggggctgatgtcccggtatttgttcggggccatgccgccttcgca
gagggtattggtgaaaaattacagccagcagagcctgtagagaagtggtatttggtcata
caccccggtgtaaacatcccaacaccgattattttttctgatcctgaattaaaaagaaat
acgccaatccgcccactggcggcgcttttaagcactccatacgcaaatgattgcgaaccg
atcgcaagaaaacgttttcgcgaggttgaacaggctctttcatggctgttagaatacgcc
ccgtcacgccttaccggtaccggcgcttgtgtgtttgcagaattcgacacggagtcatcg
gcccggcaggtgttaagtattgcccctgagtggttacatggttttgtcgcccgtggtgta
aatgtttcaccattgcatcgtgtacgctcagggaaaattgaaagcagtgagcgcagataa

DBGET integrated database retrieval system