KEGG   Yersinia pestis Angola: YpAngola_A2872
Entry
YpAngola_A2872    CDS       T00635                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ypg  Yersinia pestis Angola
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypg02044]
    YpAngola_A2872
Secretion system [BR:ypg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpAngola_A2872
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABX88407
Position
3014278..3015780
AA seq 500 aa
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVS
DDAYKSIASIIAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLD
ISKDELRRNMKRYKGVAWDQSPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLA
SIGKVAASAHVPFITGAAPSVLQMESWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRY
IGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVWSNAAYAMAVNINRSFKEYGW
CTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNT
DYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQL
EGLTVSLRMVAKLPSLKDVA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtccactcaagacgcaaaaactaaacaagctacagtcgccagtgcgacggaatatagc
gattttaatacattactgactaaagaatttaaagcgaagtctgagcaaacgatagccgca
gtagaaggtgccgttaaaacgttggctgagcaagcgctggctaattcggtcacggtgtca
gacgatgcttataaaagtattgcttccattattgcagagattgatcgcaagctatcagat
cagattaacttaattttgcaccaccaagaattccagtctctggaaagcgcatggcgtggg
ctgcactatttagtcaataacaccgagactgatgagaagttgagattacgtttcctcgac
atttctaaagatgaattacgccgtaacatgaagcgttataaaggtgttgcttgggatcaa
agcccattattcaaaaaaatctatgaagaagaatatggccaattgggtggcgaaccatac
ggttgcctggtagcagactattactttgaccatactgcacctgacgttgacttgttggct
tcaattggcaaagttgccgcttctgcccacgtgccatttattacaggtgctgcaccgtct
gtgttgcaaatggaatcttggcaagaactgtcaaacccacgtgatttgacgaagatcttc
actcagaatcttgagtatgccgcatggaactcactgcgtcagtctgaagactctcgctat
atcggcctggcgatgccacgtttcttgtcgcgtctgccttatgggattaacaccaatccg
gtagatgccttccactttgaagagacgactgatggcgcggatcacagcaaatatgtgtgg
tcaaatgcggcttatgcgatggctgttaacatcaaccgatctttcaaagagtatggctgg
tgtacgctgattcgtggtgtggaaagtggtggtgttgttgaaggcctgccatgccatacc
ttcccgacggatgacggcggtattgatatgaaatgcccaacagaaatcgctatttctgac
cgtcgtgaagcggaactggccaagaatggctttattccactggttcacagaaagaatacg
gattacgcggcattcattggcgcgcagtccctgcaaaaacctgcagaatattacgattcg
gatgcaacggcgaacgccaacctttccgctcgtctgccatacctgtttgcttgttcacgt
tttgcacattatctgaagtgcatcgtgcgtgacaaaatcggctcttttaaagagcgtgat
gagatgcaacgttggttgaatgattgggtgatgaactatgttgatggtgacccagctaac
tcttccctggaaactaaagcgcgccgtcctttagccgccgctgaagtgattgttgaagaa
gttgaaggtaaccctggttactatcaggctaaattcttcttacgccctcatttccagtta
gaaggtttgacagtatccctgcgtatggttgctaaactgccttcgctgaaagacgtagca
taa

DBGET integrated database retrieval system