KEGG   Yersinia pestis Angola: YpAngola_A2873
Entry
YpAngola_A2873    CDS       T00635                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypg  Yersinia pestis Angola
Pathway
ypg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YpAngola_A2873
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypg02044]
    YpAngola_A2873
Secretion system [BR:ypg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpAngola_A2873
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABX86206
Structure
PDB: 
3V4H

Position
3016106..3016591
AA seq 161 aa
MAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHSGSGGGSGKASVSDFCFAH
YIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETR
PREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcgcaagatatgtttatcaaaattgatggtattgaaggtgagtctttggatgccaat
cacaaaaacgaaatccaggtattagcttggaactgggatgttgctcaacactcgaatatg
cacagcggttcaggtggcggttcaggtaaagcctctgtttcagatttttgcttcgcacat
tatatcgataaagctagcccgaacttattgagctattgcttgttgggtaagcacattaaa
aatgttcagttcgtactgcgtaaagctggtggcgatccgctggaatatctgacaattaaa
tttaccgatgtcatcattactcgtgttgatatggcgggttctttggaagatgaaacgcgt
ccacgtgaagaaattcgtttctcattcactaagatgactcaggactatgttatgcagaat
gctgaaggccataagtctggcgttatttctgctaactacgatgttaaagctaacatgcac
agctaa

DBGET integrated database retrieval system