KEGG   Yersinia pestis Angola: YpAngola_A3014Help
Entry
YpAngola_A3014    CDS       T00635                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00790  Folate biosynthesis
ypg01100  Metabolic pathways
Module
ypg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YpAngola_A3014 (folE)
Enzymes [BR:ypg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     YpAngola_A3014 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABX87571
UniProt: A9R1B1
Structure
PDB: 

Position
3184441..3185103
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAELVHQALLARGLETPLRKPELDAETRKTRIQAHMTEVMHLLNLDLTDDSLAD
TPRRIAKMYVDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctaagtaaagaagctgagttggttcatcaagcgctgctggcccgtggtctt
gaaacccctttacgtaaaccagaattagatgccgagacgcgcaaaactcggattcaggcc
catatgacagaagtcatgcatttgctgaatcttgatttaaccgacgatagtctggctgat
acaccaagacgcattgcgaagatgtatgttgatgagattttctccggattggattacgaa
aatttccctaaaatcacactgattcaaaataaaatgaaagttgatgaaatggtaacggta
cgggatatcactctgaccagcacctgcgaacatcattttgtgacgattgatgggaaagcc
accgtcgcttatattccgaaagacagtgtcattggtttgtcgaaaatcaaccgtatcgtg
cagttttttgcgcagcgtccgcaagtgcaggaacgattaacacagcagatcttgctcgca
ttacaaaccctgttgggtaccaataatgtcgcagtttctattgatgcagttcattattgc
gttaaagcacgtggtatccgtgatgcgaccagcgcgacgaccaccacatcattaggcggg
ttatttaaatccagtcagaatacgcgtcaggaatttctgcgtgcggttcgtcaccacggc
tga

DBGET integrated database retrieval system