KEGG   Yersinia pestis Angola: YpAngola_A3023Help
Entry
YpAngola_A3023    CDS       T00635                                 

Gene name
cdd
Definition
(GenBank) cytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00240  Pyrimidine metabolism
ypg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YpAngola_A3023 (cdd)
Enzymes [BR:ypg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     YpAngola_A3023 (cdd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCMP_cyt_deam_2 dCMP_cyt_deam_1 DUF5447 MafB19-deam SNAD4 Pput2613-deam
Motif
Other DBs
NCBI-ProteinID: ABX84952
UniProt: A9R1B9
Position
complement(3195024..3195908)
Genome map
AA seq 294 aa AA seqDB search
MQARFHTSWAELPASLQFALEPILSAENFPAMLTAEQVKTVKNISGLDDDALAFALLPLA
TACALTPISHFNVGAIARGKSGNFYFGANMEFRGVPLQQTIHAEQCAVTHAWLRGETNLV
AITVNYTPCGHCRQFMNELNSGSELHIHLPGRPPSTLGQYLPDSFGPTDLAITTLLMDPV
NHGYTLAETDPLTQAALNAANHSHAPYSQSHSGVALETTNGKIYAGRYAENAAFNPSLPP
LQAALILANITGENCASIRRAVLVEGHNAVTSQWDTTLATLNALGCSAVKRVTF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcacgttttcacacctcttgggctgagttacccgcctcattacaattcgcacta
gaacctattctgagcgcagaaaacttccctgctatgctgaccgctgagcaagtgaaaaca
gtaaaaaatatcagtggcctggatgatgatgccttggcttttgccttgttaccgctagca
accgcttgtgcgcttacgcctatatcccattttaatgtgggtgccattgcccgtggaaaa
agtggtaatttttatttcggtgccaatatggagttccgtggtgtaccactgcaacagacg
atccacgccgagcaatgcgcggtaacccatgcctggctgcgtggtgaaaccaatctggtt
gcgatcactgtcaattacacgccatgtggccattgccgccaatttatgaatgaattgaac
agtgggtctgaattacatattcatctacctggccgcccgccatcaacactgggccaatat
ttaccagactcttttggaccaacagatttagcgatcacaacacttttgatggaccccgtg
aatcacggttacacgctagcagaaaccgatccccttacgcaggcagcgttaaatgctgca
aatcatagccatgcgccatacagccaatcccacagtggtgtggcactagaaaccaccaat
ggaaaaatttatgctggccgttatgctgaaaatgccgcctttaaccctagcctgcccccc
ctgcaagccgcgctaatcttggccaatatcaccggtgagaattgtgcgtcgatccgccgc
gctgtactggttgaaggccataacgcagtcacgagccagtgggatacaaccttggcgaca
ttgaacgccttgggctgttcagcggtaaaacgcgtgacgttttaa

DBGET integrated database retrieval system