KEGG   Yersinia pestis Angola: YpAngola_A3822Help
Entry
YpAngola_A3822    CDS       T00635                                 

Gene name
rpiA2
Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00030  Pentose phosphate pathway
ypg01100  Metabolic pathways
ypg01110  Biosynthesis of secondary metabolites
ypg01120  Microbial metabolism in diverse environments
ypg01130  Biosynthesis of antibiotics
ypg01200  Carbon metabolism
ypg01230  Biosynthesis of amino acids
Module
ypg_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YpAngola_A3822 (rpiA2)
Enzymes [BR:ypg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     YpAngola_A3822 (rpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC RNase_PH_C Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ABX86286
Position
4056269..4056925
Genome map
AA seq 218 aa AA seqDB search
MTQDELKKAVGWAALDYVKPGTIVGVGTGSTAAHFIDALGSIKHQIEGAVSSSDASTAKL
KSYGIPVFDCNDVDVLDIYVDGADEINGQMQMIKGGGAALTREKIIAAIARKFICIADES
KQVGVLGKFPLPVEVIPMARSYVARELIKLGGLPEYRQNVLTDNGNVILDVHNLSILDAI
ALENQINGIAGVVTVGLFANRGADVALIGTANGVKVIG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggatgaacttaaaaaagcggtgggctgggcagcattagattacgttaaaccc
ggtacgattgtgggtgtcggcacgggttcaactgcggcgcattttattgacgcgctaggc
tcgattaaacatcagatcgaaggggctgtttccagttctgatgcttcaaccgccaagctg
aaaagctatggtatcccagtatttgattgtaatgacgttgatgtattggatatctatgtt
gatggtgctgacgaaattaacggccaaatgcagatgattaaaggcggtggcgcagcactg
acccgagagaagattattgcggctatcgcccggaagtttatctgtattgctgatgaatcc
aaacaagttggtgtgctgggtaaattccccctgccagtcgaagtgatcccgatggcccgc
tcttatgtggcgcgtgagctgattaaattgggtggtttgcctgaataccgtcagaatgtc
ctgaccgataacggtaacgttattctggatgtccacaacttgagtattttggatgctatc
gctttagagaaccaaattaatggcattgccggtgtcgtaacggtggggctatttgcgaat
cgcggtgctgatgtggccctgattggtacggccaatggcgttaaagtgattggctaa

DBGET integrated database retrieval system