KEGG   Yersinia pestis Angola: YpAngola_A3903
Entry
YpAngola_A3903    CDS       T00635                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
ypg  Yersinia pestis Angola
Brite
KEGG Orthology (KO) [BR:ypg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypg02044]
    YpAngola_A3903
Secretion system [BR:ypg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpAngola_A3903
SSDB
Motif
Pfam: GPW_gp25 RdRP_4 baeRF_family3
Other DBs
NCBI-ProteinID: ABX87761
Position
complement(4146737..4147177)
AA seq 146 aa
MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNEVLNSRPGACQSAVDL
GVIDLNDATATSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLNHGDPLQLSFHISARVN
FDDMGDVVEFNIQLDNNRRYCFNQET
NT seq 441 nt   +upstreamnt  +downstreamnt
atggccgcgcttcttaattgggatcgagggagttctgccagtttgtttgaccgcatacag
gggaagggcgctagctcttcctccgatggccgtctgcgtgagctattgaattcaatccaa
aagcatttgaacgaggtccttaactctcgtccaggtgcttgccaaagtgcggtcgatctc
ggggttatcgacctcaatgatgcgaccgccacctcatctgattttcgaaaaagtattgag
aaagccattaaggattgtatcgagaactacgaaccccgaatttctgccgttacagttcaa
tccttgctgaaccatggcgacccactgcaactgagtttccatattagcgctcgtgttaat
ttcgacgatatgggtgatgtcgttgagttcaacattcagttagacaataaccgccgttac
tgctttaaccaggaaacataa

DBGET integrated database retrieval system